Homologs in group_1077

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_05640 FBDBKF_05640 100.0 Morganella morganii S1 sapF putrescine export ABC transporter ATP-binding protein SapF
EHELCC_11950 EHELCC_11950 100.0 Morganella morganii S2 sapF putrescine export ABC transporter ATP-binding protein SapF
NLDBIP_12290 NLDBIP_12290 100.0 Morganella morganii S4 sapF putrescine export ABC transporter ATP-binding protein SapF
LHKJJB_12150 LHKJJB_12150 100.0 Morganella morganii S3 sapF putrescine export ABC transporter ATP-binding protein SapF
F4V73_RS03665 F4V73_RS03665 94.1 Morganella psychrotolerans sapF putrescine export ABC transporter ATP-binding protein SapF
PMI_RS06675 PMI_RS06675 77.7 Proteus mirabilis HI4320 sapF putrescine export ABC transporter ATP-binding protein SapF

Distribution of the homologs in the orthogroup group_1077

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1077

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AAI0 1.12e-147 416 74 0 263 3 sapF Peptide transport system ATP-binding protein SapF Shigella flexneri
P0AAH8 1.12e-147 416 74 0 263 1 sapF Putrescine export system ATP-binding protein SapF Escherichia coli (strain K12)
P0AAH9 1.12e-147 416 74 0 263 3 sapF Peptide transport system ATP-binding protein SapF Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P36638 9.58e-146 412 74 0 263 2 sapF Peptide transport system ATP-binding protein SapF Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P45289 8.5e-79 242 48 0 264 3 sapF Peptide transport system ATP-binding protein SapF Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P45094 1.47e-68 218 38 2 254 3 dppF Dipeptide transport ATP-binding protein DppF Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A0A0H2ZH52 5.08e-66 211 40 2 253 1 dppF Di/tripeptide transport ATP-binding protein DppF Pseudomonas aeruginosa (strain UCBPP-PA14)
P37313 7.12e-66 211 39 2 254 1 dppF Dipeptide transport ATP-binding protein DppF Escherichia coli (strain K12)
P45051 3.57e-59 194 40 5 257 3 oppF Oligopeptide transport ATP-binding protein OppF Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q0T6D3 1.17e-58 199 41 2 255 3 gsiA Glutathione import ATP-binding protein GsiA Shigella flexneri serotype 5b (strain 8401)
Q0T6D3 2.74e-33 130 32 6 268 3 gsiA Glutathione import ATP-binding protein GsiA Shigella flexneri serotype 5b (strain 8401)
Q83LT3 1.2e-58 199 41 2 255 3 gsiA Glutathione import ATP-binding protein GsiA Shigella flexneri
Q83LT3 7.03e-34 132 33 6 268 3 gsiA Glutathione import ATP-binding protein GsiA Shigella flexneri
Q323W5 4.81e-58 198 41 2 255 3 gsiA Glutathione import ATP-binding protein GsiA Shigella boydii serotype 4 (strain Sb227)
Q323W5 4.47e-35 135 33 6 268 3 gsiA Glutathione import ATP-binding protein GsiA Shigella boydii serotype 4 (strain Sb227)
Q32IB5 7.86e-58 197 41 2 255 3 gsiA Glutathione import ATP-binding protein GsiA Shigella dysenteriae serotype 1 (strain Sd197)
Q32IB5 4.34e-35 135 33 6 268 3 gsiA Glutathione import ATP-binding protein GsiA Shigella dysenteriae serotype 1 (strain Sd197)
P75796 8.02e-58 197 41 2 255 1 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli (strain K12)
P75796 7.86e-35 135 33 5 268 1 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli (strain K12)
Q1RE96 8.63e-58 197 41 2 255 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli (strain UTI89 / UPEC)
Q1RE96 1.91e-36 139 33 5 268 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli (strain UTI89 / UPEC)
Q3Z3V4 8.91e-58 197 41 2 255 3 gsiA Glutathione import ATP-binding protein GsiA Shigella sonnei (strain Ss046)
Q3Z3V4 4.6e-35 135 32 5 267 3 gsiA Glutathione import ATP-binding protein GsiA Shigella sonnei (strain Ss046)
Q0TJM0 1.12e-57 197 41 2 255 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q0TJM0 1.89e-35 137 32 5 268 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q8X6W1 1.47e-57 197 41 2 255 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli O157:H7
Q8X6W1 4.56e-35 135 33 5 267 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli O157:H7
Q8FJL0 2.14e-57 196 41 3 255 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8FJL0 2.17e-35 136 32 5 268 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A1A967 3.77e-56 193 40 2 255 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli O1:K1 / APEC
A1A967 1.5e-36 140 33 5 268 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli O1:K1 / APEC
Q5PGP3 1.38e-55 191 40 4 257 3 gsiA Glutathione import ATP-binding protein GsiA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q5PGP3 2.78e-34 133 33 5 265 3 gsiA Glutathione import ATP-binding protein GsiA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q8Z864 1.4e-55 191 40 4 257 3 gsiA Glutathione import ATP-binding protein GsiA Salmonella typhi
Q8Z864 1.42e-33 131 33 5 265 3 gsiA Glutathione import ATP-binding protein GsiA Salmonella typhi
Q8ZQM4 1.47e-55 191 40 4 257 3 gsiA Glutathione import ATP-binding protein GsiA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8ZQM4 3.82e-34 133 33 5 265 3 gsiA Glutathione import ATP-binding protein GsiA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q57RB2 1.57e-55 191 40 4 257 3 gsiA Glutathione import ATP-binding protein GsiA Salmonella choleraesuis (strain SC-B67)
Q57RB2 5.08e-34 132 33 5 265 3 gsiA Glutathione import ATP-binding protein GsiA Salmonella choleraesuis (strain SC-B67)
Q53194 4.83e-55 184 38 4 257 3 NGR_a01400 Probable peptide ABC transporter ATP-binding protein y4tS Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P77737 1.49e-54 182 38 5 257 1 oppF Oligopeptide transport ATP-binding protein OppF Escherichia coli (strain K12)
Q6D3A9 1.54e-54 189 39 2 255 3 gsiA Glutathione import ATP-binding protein GsiA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q6D3A9 5.67e-35 135 33 6 268 3 gsiA Glutathione import ATP-binding protein GsiA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
P42065 7.52e-54 180 36 3 255 3 appF Oligopeptide transport ATP-binding protein AppF Bacillus subtilis (strain 168)
P08007 3.39e-53 178 38 5 257 1 oppF Oligopeptide transport ATP-binding protein OppF Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P77622 7.09e-50 169 36 3 256 2 ddpF Probable D,D-dipeptide transport ATP-binding protein DdpF Escherichia coli (strain K12)
P18766 8.98e-50 169 35 7 261 3 amiF Oligopeptide transport ATP-binding protein AmiF Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q8P2L5 1.58e-49 168 35 5 259 3 oppF Oligopeptide transport ATP-binding protein OppF Streptococcus pyogenes serotype M18 (strain MGAS8232)
P0A2V5 1.78e-49 168 33 2 254 3 oppF Oligopeptide transport ATP-binding protein OppF Lactococcus lactis subsp. cremoris (strain SK11)
P0A2V4 1.78e-49 168 33 2 254 1 oppF Oligopeptide transport ATP-binding protein OppF Lactococcus lactis subsp. lactis (strain IL1403)
P0CZ33 2.3e-49 168 35 5 259 3 oppF Oligopeptide transport ATP-binding protein OppF Streptococcus pyogenes serotype M3 (strain SSI-1)
Q5XDU4 2.3e-49 168 35 5 259 3 oppF Oligopeptide transport ATP-binding protein OppF Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0CZ32 2.3e-49 168 35 5 259 3 oppF Oligopeptide transport ATP-binding protein OppF Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P0A2V6 2.3e-49 168 35 5 259 3 oppF Oligopeptide transport ATP-binding protein OppF Streptococcus pyogenes serotype M1
P24137 6.23e-49 166 35 4 259 1 oppF Oligopeptide transport ATP-binding protein OppF Bacillus subtilis (strain 168)
C0SP98 8.55e-49 167 36 4 254 3 ykfD Putative oligopeptide transport ATP-binding protein YkfD Bacillus subtilis (strain 168)
Q2YJJ8 2.19e-48 166 36 1 234 3 BAB2_1053 Putative peptide import ATP-binding protein BAB2_1053 Brucella abortus (strain 2308)
Q8VQK7 2.19e-48 166 36 1 234 3 BruAb2_1034 Putative peptide import ATP-binding protein BruAb2_1034 Brucella abortus biovar 1 (strain 9-941)
Q2RS22 2.32e-48 164 40 2 231 3 nikE Nickel import ATP-binding protein NikE Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
P72479 7.76e-48 164 35 4 254 3 oppF Oligopeptide transport ATP-binding protein OppF Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
A2RI78 1.92e-47 163 36 6 259 1 dppF Dipeptide transport ATP-binding protein DppF Lactococcus lactis subsp. cremoris (strain MG1363)
Q8YDH1 5.1e-47 164 36 1 231 3 BMEII0205 Putative peptide import ATP-binding protein BMEII0205 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
P33916 3.8e-46 164 38 7 263 1 yejF Uncharacterized ABC transporter ATP-binding protein YejF Escherichia coli (strain K12)
P33916 5.75e-32 126 33 5 264 1 yejF Uncharacterized ABC transporter ATP-binding protein YejF Escherichia coli (strain K12)
A9CKL2 3.91e-45 162 35 5 261 3 yejF Peptidoglycan transport ATP-binding protein YejF Agrobacterium fabrum (strain C58 / ATCC 33970)
A9CKL2 6.41e-36 137 34 7 265 3 yejF Peptidoglycan transport ATP-binding protein YejF Agrobacterium fabrum (strain C58 / ATCC 33970)
Q2FVF1 7.3e-45 154 35 6 249 1 cntF Metal-staphylopine import system ATP-binding protein CntF Staphylococcus aureus (strain NCTC 8325 / PS 47)
A0A0H3JT74 1.86e-44 153 35 6 249 1 cntF Metal-staphylopine import system ATP-binding protein CntF Staphylococcus aureus (strain Mu50 / ATCC 700699)
P63396 2.15e-43 158 37 4 253 3 BQ2027_MB1312C Uncharacterized ABC transporter ATP-binding protein Mb1312c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P63396 8.83e-24 103 30 6 238 3 BQ2027_MB1312C Uncharacterized ABC transporter ATP-binding protein Mb1312c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WQJ5 2.15e-43 158 37 4 253 1 Rv1281c Uncharacterized ABC transporter ATP-binding protein Rv1281c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQJ5 8.83e-24 103 30 6 238 1 Rv1281c Uncharacterized ABC transporter ATP-binding protein Rv1281c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQJ4 2.15e-43 158 37 4 253 3 MT1318 Uncharacterized ABC transporter ATP-binding protein MT1318 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P9WQJ4 8.83e-24 103 30 6 238 3 MT1318 Uncharacterized ABC transporter ATP-binding protein MT1318 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q8YBN5 1.13e-42 150 32 2 266 3 BMEII0864 Putative peptide import ATP-binding protein BMEII0864 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q8FWP2 1.13e-42 150 32 2 266 3 BRA0404 Putative peptide import ATP-binding protein BRA0404/BS1330_II0401 Brucella suis biovar 1 (strain 1330)
Q2YK62 1.13e-42 150 32 2 266 3 BAB2_0818 Putative peptide import ATP-binding protein BAB2_0818 Brucella abortus (strain 2308)
Q577J4 1.13e-42 150 32 2 266 3 BruAb2_0797 Putative peptide import ATP-binding protein BruAb2_0797 Brucella abortus biovar 1 (strain 9-941)
A5VU86 1.13e-42 150 32 2 266 3 BOV_A0347 Putative peptide import ATP-binding protein BOV_A0347 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
A2RI77 3.44e-42 150 36 7 261 1 dppD Dipeptide transport ATP-binding protein DppD Lactococcus lactis subsp. cremoris (strain MG1363)
P50980 4.8e-41 147 34 6 261 3 oppD Oligopeptide transport ATP-binding protein OppD Lactococcus lactis subsp. cremoris (strain SK11)
Q88RL5 6.24e-41 147 33 5 250 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q1IGZ0 9.43e-41 146 34 6 251 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas entomophila (strain L48)
Q9HT70 1.13e-40 146 33 5 251 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02DK6 1.13e-40 146 33 5 251 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas aeruginosa (strain UCBPP-PA14)
Q07733 1.23e-40 146 34 6 261 1 oppD Oligopeptide transport ATP-binding protein OppD Lactococcus lactis subsp. lactis (strain IL1403)
Q3KK97 1.31e-40 145 33 5 251 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas fluorescens (strain Pf0-1)
Q48PU6 3.02e-40 145 33 5 251 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q4ZZR8 1.53e-39 143 33 5 251 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas syringae pv. syringae (strain B728a)
P24136 1.66e-39 143 33 6 260 1 oppD Oligopeptide transport ATP-binding protein OppD Bacillus subtilis (strain 168)
Q63H29 1.77e-39 143 32 5 265 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus cereus (strain ZK / E33L)
Q4KKK8 3.34e-39 142 33 5 251 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q81VM2 4.29e-39 142 32 5 265 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus anthracis
P42064 5.23e-39 141 33 6 261 3 appD Oligopeptide transport ATP-binding protein AppD Bacillus subtilis (strain 168)
Q87UN4 7.08e-39 141 33 5 251 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q81IZ6 7.5e-39 141 31 6 269 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q32AQ1 7.67e-39 139 36 3 231 3 nikE Nickel import ATP-binding protein NikE Shigella dysenteriae serotype 1 (strain Sd197)
Q03Z27 8.68e-39 142 32 5 266 3 metN Methionine import ATP-binding protein MetN Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
Q1R5D8 1.19e-38 139 36 3 231 3 nikE Nickel import ATP-binding protein NikE Escherichia coli (strain UTI89 / UPEC)
Q8FCM9 1.19e-38 139 36 3 231 3 nikE Nickel import ATP-binding protein NikE Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TBX8 1.19e-38 139 36 3 231 3 nikE Nickel import ATP-binding protein NikE Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q8FVN0 1.44e-38 139 38 3 222 2 nikE Nickel import ATP-binding protein NikE Brucella suis biovar 1 (strain 1330)
Q8YCN7 1.46e-38 139 38 3 222 3 nikE Nickel import ATP-binding protein NikE Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q578S7 1.46e-38 139 38 3 222 3 nikE Nickel import ATP-binding protein NikE Brucella abortus biovar 1 (strain 9-941)
Q2YL69 1.46e-38 139 38 3 222 3 nikE Nickel import ATP-binding protein NikE Brucella abortus (strain 2308)
P26905 1.72e-38 140 32 6 261 3 dppD Dipeptide transport ATP-binding protein DppD Bacillus subtilis (strain 168)
Q8X4L6 2.18e-38 138 35 3 239 3 nikE Nickel import ATP-binding protein NikE Escherichia coli O157:H7
Q31VE6 3.88e-38 137 36 3 231 3 nikE Nickel import ATP-binding protein NikE Shigella boydii serotype 4 (strain Sb227)
Q3YW48 3.96e-38 137 36 3 231 3 nikE Nickel import ATP-binding protein NikE Shigella sonnei (strain Ss046)
Q8ELQ6 5.8e-38 139 34 6 252 3 metN3 Methionine import ATP-binding protein MetN 3 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
P33594 6.6e-38 137 35 3 231 3 nikE Nickel import ATP-binding protein NikE Escherichia coli (strain K12)
Q73F11 9.73e-38 139 31 5 265 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q832Y6 9.89e-38 139 33 7 262 3 metN1 Methionine import ATP-binding protein MetN 1 Enterococcus faecalis (strain ATCC 700802 / V583)
P0AAG2 1.32e-37 138 34 7 260 3 dppD Dipeptide transport ATP-binding protein DppD Shigella flexneri
P0AAG0 1.32e-37 138 34 7 260 1 dppD Dipeptide transport ATP-binding protein DppD Escherichia coli (strain K12)
P0AAG1 1.32e-37 138 34 7 260 3 dppD Dipeptide transport ATP-binding protein DppD Escherichia coli O157:H7
Q49W48 4.08e-37 137 32 8 259 3 metN Methionine import ATP-binding protein MetN Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q83J77 8.32e-37 134 35 3 231 3 nikE Nickel import ATP-binding protein NikE Shigella flexneri
Q6NJ07 8.44e-37 136 32 7 256 3 metN Methionine import ATP-binding protein MetN Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
Q8ELA5 8.88e-37 136 33 5 254 3 metN4 Methionine import ATP-binding protein MetN 4 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q0SZJ3 1.01e-36 134 35 3 231 3 nikE Nickel import ATP-binding protein NikE Shigella flexneri serotype 5b (strain 8401)
O26096 1.04e-36 135 32 6 252 3 metN Methionine import ATP-binding protein MetN Helicobacter pylori (strain ATCC 700392 / 26695)
Q9ZJ34 1.13e-36 135 32 6 252 3 metN Methionine import ATP-binding protein MetN Helicobacter pylori (strain J99 / ATCC 700824)
Q8FRX8 1.41e-36 135 32 7 255 3 metN Methionine import ATP-binding protein MetN Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
P76027 1.48e-36 135 33 6 263 1 oppD Oligopeptide transport ATP-binding protein OppD Escherichia coli (strain K12)
Q6FAN3 1.7e-36 135 33 5 247 3 metN1 Methionine import ATP-binding protein MetN 1 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
P45052 2.09e-36 134 34 5 251 3 oppD Oligopeptide transport ATP-binding protein OppD Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8NY21 2.52e-36 135 30 7 259 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain MW2)
Q6GC27 2.52e-36 135 30 7 259 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain MSSA476)
Q17VE0 2.66e-36 134 32 6 252 3 metN Methionine import ATP-binding protein MetN Helicobacter acinonychis (strain Sheeba)
P04285 3.97e-36 134 33 6 263 1 oppD Oligopeptide transport ATP-binding protein OppD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q5HIL5 4e-36 134 30 7 259 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain COL)
Q2G0V2 4e-36 134 30 7 259 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FJI0 4e-36 134 30 7 259 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain USA300)
Q8CQS7 4.49e-36 134 30 7 252 3 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HRU5 4.49e-36 134 30 7 252 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q1CR30 6.87e-36 133 31 7 268 3 metN Methionine import ATP-binding protein MetN Helicobacter pylori (strain HPAG1)
Q2YVT7 8.62e-36 133 30 7 259 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q7A7E3 1.29e-35 133 30 7 259 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain N315)
Q99WE1 1.29e-35 133 30 7 259 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain Mu50 / ATCC 700699)
P0A2U9 2.63e-35 132 33 8 262 3 amiE Oligopeptide transport ATP-binding protein AmiE Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A2U8 2.63e-35 132 33 8 262 3 amiE Oligopeptide transport ATP-binding protein AmiE Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
P14175 3.02e-35 133 33 8 264 1 proV Glycine betaine/proline betaine transport system ATP-binding protein ProV Escherichia coli (strain K12)
Q6GJL2 3.04e-35 132 30 7 259 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain MRSA252)
Q8PGE8 4.6e-35 131 33 9 262 3 metN Methionine import ATP-binding protein MetN Xanthomonas axonopodis pv. citri (strain 306)
Q6N9W0 5.91e-35 132 33 7 242 3 metN1 Methionine import ATP-binding protein MetN 1 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
P17328 7.38e-35 132 34 8 264 2 proV Glycine betaine/proline betaine transport system ATP-binding protein ProV Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q3BNZ3 8.11e-35 130 33 9 262 3 metN Methionine import ATP-binding protein MetN Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q8YDH0 1.24e-34 130 34 6 262 3 BMEII0206 Putative peptide import ATP-binding protein BMEII0206 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q4QMH4 1.25e-34 130 32 6 268 3 metN Methionine import ATP-binding protein MetN Haemophilus influenzae (strain 86-028NP)
Q3A9G5 1.26e-34 130 30 6 259 3 metN Methionine import ATP-binding protein MetN Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q4L4R9 1.56e-34 130 29 6 254 3 metN Methionine import ATP-binding protein MetN Staphylococcus haemolyticus (strain JCSC1435)
P45095 1.63e-34 130 32 9 273 3 dppD Dipeptide transport ATP-binding protein DppD Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q5WDP1 1.83e-34 130 32 5 250 3 metN3 Methionine import ATP-binding protein MetN 3 Shouchella clausii (strain KSM-K16)
Q0SFY5 1.99e-34 129 35 7 241 3 metN1 Methionine import ATP-binding protein MetN 1 Rhodococcus jostii (strain RHA1)
P44785 2.85e-34 129 32 6 268 3 metN Methionine import ATP-binding protein MetN Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q81IN8 2.94e-34 129 33 7 241 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q8FUW8 3.46e-34 129 34 6 262 3 BRA1094 Putative peptide import ATP-binding protein BRA1094/BS1330_II1086 Brucella suis biovar 1 (strain 1330)
Q2YJJ9 3.46e-34 129 34 6 262 3 BAB2_1052 Putative peptide import ATP-binding protein BAB2_1052 Brucella abortus (strain 2308)
Q8VQK6 3.46e-34 129 34 6 262 3 BruAb2_1033 Putative peptide import ATP-binding protein BruAb2_1033 Brucella abortus biovar 1 (strain 9-941)
Q8YBN6 3.74e-34 129 33 9 271 3 BMEII0863 Putative peptide import ATP-binding protein BMEII0863 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
A5VU87 4.07e-34 129 33 9 271 3 BOV_A0348 Putative peptide import ATP-binding protein BOV_A0348 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q7VV72 4.28e-34 129 33 7 260 3 metN Methionine import ATP-binding protein MetN Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W4E1 4.28e-34 129 33 7 260 3 metN Methionine import ATP-binding protein MetN Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WFU9 4.28e-34 129 33 7 260 3 metN Methionine import ATP-binding protein MetN Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q8NSN2 4.48e-34 129 30 7 254 3 metN Methionine import ATP-binding protein MetN Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q9CK97 6.33e-34 128 33 7 262 3 metN Methionine import ATP-binding protein MetN Pasteurella multocida (strain Pm70)
Q92EZ6 6.38e-34 128 33 6 253 3 metN1 Methionine import ATP-binding protein MetN 1 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q88HL0 6.89e-34 127 31 2 230 3 nikE Nickel import ATP-binding protein NikE Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q7VI92 7.16e-34 128 30 6 253 3 metN Methionine import ATP-binding protein MetN Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Q2SY12 7.41e-34 128 35 7 254 3 metN Methionine import ATP-binding protein MetN Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q65VG9 8.83e-34 128 31 7 263 3 metN Methionine import ATP-binding protein MetN Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q0I5E9 1e-33 128 31 5 254 3 metN Methionine import ATP-binding protein MetN Histophilus somni (strain 129Pt)
Q5H503 1.15e-33 127 33 9 262 3 metN Methionine import ATP-binding protein MetN Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q8RFN2 1.31e-33 127 32 5 233 3 metN Methionine import ATP-binding protein MetN Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q2P7S3 1.32e-33 127 33 9 262 3 metN Methionine import ATP-binding protein MetN Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q8FWP1 1.66e-33 127 32 9 271 3 BRA0405 Putative peptide import ATP-binding protein BRA0405/BS1330_II0402 Brucella suis biovar 1 (strain 1330)
Q73EL7 1.78e-33 127 32 9 265 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q63GR8 1.91e-33 127 32 9 265 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus cereus (strain ZK / E33L)
Q2YK63 2.04e-33 127 32 9 271 3 BAB2_0817 Putative peptide import ATP-binding protein BAB2_0817 Brucella abortus (strain 2308)
Q577J5 2.04e-33 127 32 9 271 3 BruAb2_0796 Putative peptide import ATP-binding protein BruAb2_0796 Brucella abortus biovar 1 (strain 9-941)
Q8YA75 2.31e-33 127 31 6 255 3 metN1 Methionine import ATP-binding protein MetN 1 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q8P4S7 2.35e-33 127 32 9 262 3 metN Methionine import ATP-binding protein MetN Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UQD2 2.35e-33 127 32 9 262 3 metN Methionine import ATP-binding protein MetN Xanthomonas campestris pv. campestris (strain 8004)
Q81ZF5 2.59e-33 127 32 9 265 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus anthracis
Q6HP89 2.88e-33 127 32 9 265 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q8DZJ0 3.16e-33 127 31 6 258 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E554 3.16e-33 127 31 6 258 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus agalactiae serotype III (strain NEM316)
Q3K0Y6 3.16e-33 127 31 6 258 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
P54537 3.42e-33 124 34 8 241 1 artM Arginine transport ATP-binding protein ArtM Bacillus subtilis (strain 168)
Q8G5P8 3.76e-33 127 32 6 257 3 metN Methionine import ATP-binding protein MetN Bifidobacterium longum (strain NCC 2705)
Q724C0 3.82e-33 126 31 6 255 3 metN1 Methionine import ATP-binding protein MetN 1 Listeria monocytogenes serotype 4b (strain F2365)
Q134N9 4.53e-33 127 33 7 242 3 metN Methionine import ATP-binding protein MetN Rhodopseudomonas palustris (strain BisB5)
Q04DA7 4.91e-33 126 29 9 274 3 metN2 Methionine import ATP-binding protein MetN 2 Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q21BU8 6.08e-33 126 31 9 264 3 metN Methionine import ATP-binding protein MetN Rhodopseudomonas palustris (strain BisB18)
Q4KK46 7.53e-33 126 31 6 248 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q5M5Z2 8.77e-33 125 30 5 264 3 metN Methionine import ATP-binding protein MetN Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q890R2 9.61e-33 124 31 8 246 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Clostridium tetani (strain Massachusetts / E88)
Q8NXH5 1.75e-32 124 30 6 252 3 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus aureus (strain MW2)
Q6GB18 1.75e-32 124 30 6 252 3 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus aureus (strain MSSA476)
Q5HHK4 1.75e-32 124 30 6 252 3 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus aureus (strain COL)
Q2FZZ2 1.75e-32 124 30 6 252 3 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FII2 1.75e-32 124 30 6 252 3 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus aureus (strain USA300)
Q9RR46 1.9e-32 125 33 4 227 1 gbuA Glycine betaine/carnitine transport ATP-binding protein GbuA Listeria monocytogenes serotype 1/2a (strain 10403S)
A0A0H2ZGN6 1.95e-32 124 33 7 260 1 dppD Di/tripeptide transport ATP-binding protein DppD Pseudomonas aeruginosa (strain UCBPP-PA14)
Q12B04 1.95e-32 125 33 7 251 3 metN Methionine import ATP-binding protein MetN Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q6GIH9 2e-32 124 31 6 252 3 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus aureus (strain MRSA252)
Q5M1F6 2.04e-32 125 29 5 264 3 metN Methionine import ATP-binding protein MetN Streptococcus thermophilus (strain CNRZ 1066)
Q7A6M2 2.04e-32 124 30 6 252 1 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus aureus (strain N315)
Q99VG8 2.04e-32 124 30 6 252 1 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q72Y96 2.57e-32 124 29 5 247 3 metN3 Methionine import ATP-binding protein MetN 3 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q815Y7 2.65e-32 124 29 5 247 3 metN3 Methionine import ATP-binding protein MetN 3 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q2YWP2 2.77e-32 124 30 6 252 3 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q6HBS0 3.41e-32 124 29 5 247 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q5HQQ9 3.59e-32 124 32 5 231 3 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q8P2K6 3.86e-32 124 29 9 285 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q07LR5 3.92e-32 124 31 7 245 3 metN Methionine import ATP-binding protein MetN Rhodopseudomonas palustris (strain BisA53)
E0SCY1 3.97e-32 125 34 8 243 1 ousV Glycine betaine/choline transport system ATP-binding protein OusV Dickeya dadantii (strain 3937)
Q2KVK2 4.05e-32 124 31 8 263 3 metN Methionine import ATP-binding protein MetN Bordetella avium (strain 197N)
Q8E3S0 4.08e-32 124 30 6 257 3 metN Methionine import ATP-binding protein MetN Streptococcus agalactiae serotype III (strain NEM316)
Q6D1C4 4.45e-32 124 33 8 252 3 metN3 Methionine import ATP-binding protein MetN 3 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q631Y4 5.34e-32 123 29 5 247 3 metN3 Methionine import ATP-binding protein MetN 3 Bacillus cereus (strain ZK / E33L)
Q8DY54 5.46e-32 124 30 6 257 3 metN Methionine import ATP-binding protein MetN Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q3JZP8 5.46e-32 124 30 6 257 3 metN Methionine import ATP-binding protein MetN Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q81XL3 6.05e-32 123 29 5 247 3 metN3 Methionine import ATP-binding protein MetN 3 Bacillus anthracis
Q8DPC2 6.21e-32 124 30 6 258 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q97Q42 6.21e-32 124 30 6 258 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q04JW0 6.21e-32 124 30 6 258 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q93DA2 7.2e-32 123 31 6 247 3 metN Methionine import ATP-binding protein MetN Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q2RFS8 7.87e-32 121 38 6 215 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q8CTB2 8.27e-32 123 31 4 226 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q1J6Q6 8.86e-32 124 31 5 251 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JGY7 8.86e-32 124 31 5 251 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1JLT7 8.86e-32 124 31 5 251 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JBV6 8.86e-32 124 31 5 251 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q5XCA4 1.28e-31 123 30 5 251 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0CZ35 1.31e-31 123 30 5 251 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M3 (strain SSI-1)
Q48TP4 1.31e-31 123 30 5 251 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M28 (strain MGAS6180)
P0CZ34 1.31e-31 123 30 5 251 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q24QI5 1.63e-31 122 30 7 268 3 metN Methionine import ATP-binding protein MetN Desulfitobacterium hafniense (strain Y51)
Q6LN52 1.69e-31 122 29 5 252 3 metN Methionine import ATP-binding protein MetN Photobacterium profundum (strain SS9)
Q8Y4L8 1.72e-31 122 31 4 232 3 metN2 Methionine import ATP-binding protein MetN 2 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q63S19 1.74e-31 122 34 7 254 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia pseudomallei (strain K96243)
Q3JPZ4 1.74e-31 122 34 7 254 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia pseudomallei (strain 1710b)
Q62M41 1.74e-31 122 34 7 254 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia mallei (strain ATCC 23344)
Q71X09 1.91e-31 122 31 4 232 3 metN2 Methionine import ATP-binding protein MetN 2 Listeria monocytogenes serotype 4b (strain F2365)
Q7VM95 2.21e-31 122 31 7 266 3 metN Methionine import ATP-binding protein MetN Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q32JQ8 2.24e-31 122 32 8 257 3 metN Methionine import ATP-binding protein MetN Shigella dysenteriae serotype 1 (strain Sd197)
P30750 2.26e-31 122 32 8 257 1 metN Methionine import ATP-binding protein MetN Escherichia coli (strain K12)
Q5XDS8 2.28e-31 122 29 9 285 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q7CN92 2.31e-31 122 31 5 251 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q99ZS8 2.31e-31 122 31 5 251 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M1
Q88UV2 2.9e-31 121 31 7 259 3 metN2 Methionine import ATP-binding protein MetN 2 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q48PN3 3.11e-31 122 30 7 270 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q1CFH7 3.61e-31 121 32 6 252 3 metN2 Methionine import ATP-binding protein MetN 2 Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZH38 3.61e-31 121 32 6 252 3 metN1 Methionine import ATP-binding protein MetN 1 Yersinia pestis
Q1CAK4 3.61e-31 121 32 6 252 3 metN1 Methionine import ATP-binding protein MetN 1 Yersinia pestis bv. Antiqua (strain Antiqua)
Q38WL5 3.91e-31 121 29 6 256 3 metN Methionine import ATP-binding protein MetN Latilactobacillus sakei subsp. sakei (strain 23K)
Q3Z5F8 3.97e-31 121 32 8 257 3 metN Methionine import ATP-binding protein MetN Shigella sonnei (strain Ss046)
Q1RFY9 3.97e-31 121 32 8 257 3 metN Methionine import ATP-binding protein MetN Escherichia coli (strain UTI89 / UPEC)
P63355 3.97e-31 121 32 8 257 3 metN Methionine import ATP-binding protein MetN Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P63356 3.97e-31 121 32 8 257 3 metN Methionine import ATP-binding protein MetN Escherichia coli O157:H7
Q325U1 4.01e-31 121 32 8 257 3 metN Methionine import ATP-binding protein MetN Shigella boydii serotype 4 (strain Sb227)
Q0TLD2 4.01e-31 121 32 8 257 3 metN Methionine import ATP-binding protein MetN Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q65F80 4.07e-31 121 30 6 250 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q667L9 4.59e-31 121 32 6 252 3 metN2 Methionine import ATP-binding protein MetN 2 Yersinia pseudotuberculosis serotype I (strain IP32953)
Q6D3Q6 4.6e-31 120 33 5 239 3 metN2 Methionine import ATP-binding protein MetN 2 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q8Y0X3 4.78e-31 121 31 7 277 3 metN Methionine import ATP-binding protein MetN Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q3KJS6 4.79e-31 121 30 6 248 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas fluorescens (strain Pf0-1)
A3CMQ7 5.83e-31 121 29 6 258 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus sanguinis (strain SK36)
P0CZ31 6.06e-31 120 29 9 285 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M3 (strain SSI-1)
P0CZ30 6.06e-31 120 29 9 285 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q39IE7 8.36e-31 120 32 5 252 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q48V78 9.08e-31 120 29 9 285 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M28 (strain MGAS6180)
Q9A1E3 9.08e-31 120 29 9 285 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M1
Q1JNE0 1.07e-30 120 29 9 285 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JDG6 1.07e-30 120 29 9 285 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M12 (strain MGAS2096)
O34392 1.07e-30 117 33 9 239 2 ytrE ABC transporter ATP-binding protein YtrE Bacillus subtilis (strain 168)
Q87UV4 1.07e-30 120 30 6 248 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q88WA5 1.08e-30 120 32 9 246 3 metN1 Methionine import ATP-binding protein MetN 1 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q83MC5 1.24e-30 120 32 8 257 3 metN Methionine import ATP-binding protein MetN Shigella flexneri
Q0T810 1.24e-30 120 32 8 257 3 metN Methionine import ATP-binding protein MetN Shigella flexneri serotype 5b (strain 8401)
Q8CRI6 1.25e-30 118 32 8 243 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HM27 1.25e-30 118 32 8 243 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q1B677 1.25e-30 119 31 8 266 3 metN Methionine import ATP-binding protein MetN Mycobacterium sp. (strain MCS)
Q7A470 1.27e-30 118 33 8 236 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain N315)
Q99S47 1.27e-30 118 33 8 236 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q1JII9 1.49e-30 120 29 9 285 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1BY14 1.64e-30 119 32 5 252 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia orbicola (strain AU 1054)
A0K5N5 1.64e-30 119 32 5 252 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia cenocepacia (strain HI2424)
Q5HDY6 1.73e-30 117 33 8 236 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain COL)
Q2FW34 1.73e-30 117 33 8 236 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FER7 1.73e-30 117 33 8 236 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain USA300)
Q8NVB5 1.98e-30 117 33 8 236 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain MW2)
Q6G799 1.98e-30 117 33 8 236 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain MSSA476)
Q2YYM4 2.11e-30 117 33 8 236 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q4ZZK0 2.12e-30 120 29 7 270 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas syringae pv. syringae (strain B728a)
Q6GEL3 2.37e-30 117 33 8 236 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain MRSA252)
Q928L8 2.79e-30 119 30 4 232 3 metN2 Methionine import ATP-binding protein MetN 2 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q04F14 3.51e-30 119 28 6 252 3 metN1 Methionine import ATP-binding protein MetN 1 Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
P14788 3.97e-30 118 33 4 237 2 cysA Sulfate/thiosulfate import ATP-binding protein CysA Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q13VD7 4.01e-30 118 33 8 254 3 metN1 Methionine import ATP-binding protein MetN 1 Paraburkholderia xenovorans (strain LB400)
Q5FKL2 4.4e-30 118 28 4 265 3 metN Methionine import ATP-binding protein MetN Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q02Z10 4.4e-30 120 30 6 248 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactococcus lactis subsp. cremoris (strain SK11)
Q53193 4.67e-30 118 30 7 260 3 NGR_a01410 Probable peptide ABC transporter ATP-binding protein y4tR Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q9CGD4 5.31e-30 119 30 6 248 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactococcus lactis subsp. lactis (strain IL1403)
Q7N8M2 5.55e-30 118 32 5 230 3 metN Methionine import ATP-binding protein MetN Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q9KIF7 7.25e-30 119 32 4 227 3 opuAA Glycine betaine transport ATP-binding protein OpuAA Lactococcus lactis subsp. lactis (strain IL1403)
Q87AL9 8.43e-30 117 31 7 245 3 metN Methionine import ATP-binding protein MetN Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q88RB3 8.92e-30 118 32 5 227 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q9I1C8 9.01e-30 118 31 7 255 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9CIS9 9.05e-30 116 33 7 241 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactococcus lactis subsp. lactis (strain IL1403)
Q02ME3 9.2e-30 118 31 7 255 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas aeruginosa (strain UCBPP-PA14)
Q032H4 1.02e-29 115 33 7 241 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactococcus lactis subsp. cremoris (strain SK11)
A2RI01 1.02e-29 115 33 7 241 1 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactococcus lactis subsp. cremoris (strain MG1363)
O32169 1.1e-29 117 30 7 250 1 metN Methionine import ATP-binding protein MetN Bacillus subtilis (strain 168)
Q74K65 1.1e-29 117 31 8 250 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q9X196 1.18e-29 117 33 6 244 3 potA Spermidine/putrescine import ATP-binding protein PotA Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q5L3R0 1.28e-29 115 34 7 243 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Geobacillus kaustophilus (strain HTA426)
Q5WKL3 1.53e-29 117 30 6 268 3 metN1 Methionine import ATP-binding protein MetN 1 Shouchella clausii (strain KSM-K16)
Q97T09 1.55e-29 117 30 3 241 3 metN Methionine import ATP-binding protein MetN Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q1J8E4 1.56e-29 117 30 8 263 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q9PF03 1.75e-29 116 31 7 245 3 metN Methionine import ATP-binding protein MetN Xylella fastidiosa (strain 9a5c)
Q8FV85 1.82e-29 117 30 5 251 3 metN Methionine import ATP-binding protein MetN Brucella suis biovar 1 (strain 1330)
Q8YD40 1.82e-29 117 30 5 251 3 metN Methionine import ATP-binding protein MetN Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q579H8 1.82e-29 117 30 5 251 3 metN Methionine import ATP-binding protein MetN Brucella abortus biovar 1 (strain 9-941)
Q2YIV5 1.82e-29 117 30 5 251 3 metN Methionine import ATP-binding protein MetN Brucella abortus (strain 2308)
Q9A502 2.06e-29 116 34 5 236 3 metN Methionine import ATP-binding protein MetN Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q97EK8 2.12e-29 115 31 8 245 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q8DUF7 2.28e-29 117 30 7 260 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q74IV9 2.68e-29 116 32 7 249 3 metN Methionine import ATP-binding protein MetN Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
P39456 2.69e-29 114 29 7 255 1 tcyC L-cystine import ATP-binding protein TcyC Bacillus subtilis (strain 168)
Q0BH79 2.93e-29 116 31 5 252 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q1IGN4 2.98e-29 116 31 4 227 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas entomophila (strain L48)
Q0SFW6 3.16e-29 116 29 7 253 3 metN2 Methionine import ATP-binding protein MetN 2 Rhodococcus jostii (strain RHA1)
O34979 3.57e-29 113 34 8 238 3 yvrO Uncharacterized ABC transporter ATP-binding protein YvrO Bacillus subtilis (strain 168)
Q6KHL1 3.97e-29 114 32 6 241 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711)
Q8DRF9 4.28e-29 115 29 3 241 3 metN Methionine import ATP-binding protein MetN Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P56344 4.4e-29 113 29 7 249 3 cysA Probable sulfate/thiosulfate import ATP-binding protein CysA Chlorella vulgaris
P47326 5.01e-29 119 38 0 127 3 oppF Oligopeptide transport ATP-binding protein OppF Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
P47326 2.68e-13 73 35 2 120 3 oppF Oligopeptide transport ATP-binding protein OppF Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
P75551 5.11e-29 119 40 0 127 3 oppF Oligopeptide transport ATP-binding protein OppF Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
P75551 3.11e-13 72 35 2 119 3 oppF Oligopeptide transport ATP-binding protein OppF Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q032A0 5.38e-29 115 28 6 267 3 metN Methionine import ATP-binding protein MetN Lactococcus lactis subsp. cremoris (strain SK11)
Q02R79 5.57e-29 115 30 7 273 3 potA Spermidine/putrescine import ATP-binding protein PotA Pseudomonas aeruginosa (strain UCBPP-PA14)
D8KFN1 6.15e-29 115 28 6 267 3 metN Methionine import ATP-binding protein MetN Lactococcus lactis subsp. cremoris (strain NZ9000)
P0CI33 6.15e-29 115 28 6 267 3 metN Methionine import ATP-binding protein MetN Lactococcus lactis subsp. cremoris (strain MG1363)
Q5PID0 6.33e-29 115 30 6 252 3 metN1 Methionine import ATP-binding protein MetN 1 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
P47425 6.5e-29 114 32 6 224 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q9HY19 6.57e-29 115 30 7 273 3 potA2 Spermidine/putrescine import ATP-binding protein PotA 2 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q03JH1 6.76e-29 115 28 6 260 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q831K6 7.33e-29 115 28 6 250 1 metN2 Methionine import ATP-binding protein MetN 2 Enterococcus faecalis (strain ATCC 700802 / V583)
Q13LD8 7.4e-29 115 32 5 228 3 metN2 Methionine import ATP-binding protein MetN 2 Paraburkholderia xenovorans (strain LB400)
Q3J1N0 7.71e-29 115 30 8 267 3 metN Methionine import ATP-binding protein MetN Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q5LYN4 7.72e-29 115 28 6 260 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus thermophilus (strain CNRZ 1066)
Q5M397 7.88e-29 115 28 6 260 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q7AH43 8.82e-29 115 31 6 254 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Escherichia coli O157:H7
Q8DFC3 9.93e-29 114 29 5 252 3 metN Methionine import ATP-binding protein MetN Vibrio vulnificus (strain CMCP6)
Q7MN25 1.04e-28 114 29 5 252 3 metN Methionine import ATP-binding protein MetN Vibrio vulnificus (strain YJ016)
Q92WJ0 1.08e-28 115 33 8 270 3 fbpC1 Fe(3+) ions import ATP-binding protein FbpC 1 Rhizobium meliloti (strain 1021)
Q8Z990 1.24e-28 114 30 6 252 3 metN1 Methionine import ATP-binding protein MetN 1 Salmonella typhi
P37009 1.33e-28 114 31 6 254 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Escherichia coli (strain K12)
Q7NQN5 1.51e-28 114 30 6 254 3 potA Spermidine/putrescine import ATP-binding protein PotA Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
P16678 1.61e-28 112 30 2 257 1 phnK Putative phosphonates utilization ATP-binding protein PhnK Escherichia coli (strain K12)
Q50801 1.63e-28 112 30 7 242 3 MTBMA_c05830 Putative ABC transporter ATP-binding protein MTBMA_c05830 Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg)
Q5KVK2 1.84e-28 114 28 5 250 3 metN Methionine import ATP-binding protein MetN Geobacillus kaustophilus (strain HTA426)
Q8ENU2 1.92e-28 114 28 5 252 3 metN2 Methionine import ATP-binding protein MetN 2 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q2RWA3 1.97e-28 114 33 6 228 3 metN Methionine import ATP-binding protein MetN Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q6F9P2 2.03e-28 114 29 6 252 3 metN2 Methionine import ATP-binding protein MetN 2 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q8DMX9 2.06e-28 112 34 7 229 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q97N50 2.06e-28 112 34 7 229 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q04HV7 2.06e-28 112 34 7 229 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q87RS1 2.13e-28 114 29 5 252 1 metN Methionine import ATP-binding protein MetN Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q9CIN4 2.15e-28 114 28 6 267 3 metN Methionine import ATP-binding protein MetN Lactococcus lactis subsp. lactis (strain IL1403)
Q5PFQ7 2.16e-28 114 33 5 214 3 phnT Putative 2-aminoethylphosphonate import ATP-binding protein PhnT Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q8Z8W8 2.19e-28 114 33 5 214 3 phnT Putative 2-aminoethylphosphonate import ATP-binding protein PhnT Salmonella typhi
Q89LP2 2.25e-28 114 28 7 261 3 metN Methionine import ATP-binding protein MetN Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q1BR30 2.25e-28 114 32 4 233 3 metN2 Methionine import ATP-binding protein MetN 2 Burkholderia orbicola (strain AU 1054)
A0B344 2.25e-28 114 32 4 233 3 metN2 Methionine import ATP-binding protein MetN 2 Burkholderia cenocepacia (strain HI2424)
P96063 2.4e-28 114 33 5 214 2 phnT Putative 2-aminoethylphosphonate import ATP-binding protein PhnT Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8ZRM9 2.55e-28 114 30 6 252 3 metN1 Methionine import ATP-binding protein MetN 1 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q03EE4 2.56e-28 112 33 7 239 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
Q8DRR9 2.56e-28 112 32 7 244 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q5WJP0 2.57e-28 113 30 7 255 3 metN2 Methionine import ATP-binding protein MetN 2 Shouchella clausii (strain KSM-K16)
Q6A6X6 2.66e-28 114 29 6 257 3 metN Methionine import ATP-binding protein MetN Cutibacterium acnes (strain DSM 16379 / KPA171202)
Q8U6M1 2.77e-28 114 34 8 257 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Agrobacterium fabrum (strain C58 / ATCC 33970)
Q57T09 3.07e-28 113 30 6 252 3 metN1 Methionine import ATP-binding protein MetN 1 Salmonella choleraesuis (strain SC-B67)
Q88XV2 3.22e-28 112 32 7 243 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
P54954 3.24e-28 111 30 7 253 1 yxeO Probable amino-acid import ATP-binding protein YxeO Bacillus subtilis (strain 168)
Q8DIA0 3.29e-28 113 33 6 239 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q1WSB8 3.36e-28 112 30 7 241 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Ligilactobacillus salivarius (strain UCC118)
Q03AH0 3.87e-28 113 30 7 260 3 potA Spermidine/putrescine import ATP-binding protein PotA Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
Q8EPK1 3.94e-28 113 30 7 260 3 metN1 Methionine import ATP-binding protein MetN 1 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q04BG2 3.99e-28 113 31 5 238 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q4JTG9 4.24e-28 113 29 8 264 3 metN Methionine import ATP-binding protein MetN Corynebacterium jeikeium (strain K411)
Q042G7 4.73e-28 113 30 5 236 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
Q1GB17 4.86e-28 113 31 5 238 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
Q18C09 4.92e-28 112 32 6 238 3 metN Methionine import ATP-binding protein MetN Clostridioides difficile (strain 630)
Q65M34 4.93e-28 112 29 5 232 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q2FNX9 5.11e-28 111 28 3 238 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1)
Q0SWH9 5.31e-28 111 31 9 252 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Clostridium perfringens (strain SM101 / Type A)
Q0I2Z4 5.62e-28 112 30 6 258 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Histophilus somni (strain 129Pt)
Q8VNL9 5.73e-28 111 30 7 242 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Enterococcus faecium
Q39AT4 5.76e-28 114 32 4 233 3 metN2 Methionine import ATP-binding protein MetN 2 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q65S66 5.92e-28 112 31 5 238 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q2NHA1 6.64e-28 111 31 6 238 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3)
Q57SD6 6.69e-28 113 33 5 214 3 phnT Putative 2-aminoethylphosphonate import ATP-binding protein PhnT Salmonella choleraesuis (strain SC-B67)
Q0B6I6 6.71e-28 113 31 4 233 3 metN2 Methionine import ATP-binding protein MetN 2 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q7N8B9 7.05e-28 112 32 6 254 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q0TUN8 7.89e-28 111 31 9 252 1 ecfA3 Energy-coupling factor transporter ATP-binding protein EcfA3 Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q8U7G2 8.12e-28 112 30 6 258 3 metN Methionine import ATP-binding protein MetN Agrobacterium fabrum (strain C58 / ATCC 33970)
Q5FL41 8.31e-28 112 30 7 248 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q8TIX0 8.65e-28 112 28 3 239 3 MA_4020 Putative ABC transporter ATP-binding protein MA_4020 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q9K789 8.71e-28 112 28 5 250 3 metN Methionine import ATP-binding protein MetN Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q0KDG3 8.86e-28 112 30 6 269 3 metN Methionine import ATP-binding protein MetN Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q9Z8Q8 8.97e-28 112 30 4 239 3 metN Methionine import ATP-binding protein MetN Chlamydia pneumoniae
P44513 9.37e-28 112 32 6 249 1 fbpC2 Fe(3+) ions import ATP-binding protein FbpC 2 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8TTN2 9.83e-28 114 32 7 250 3 MA_0394 Putative ABC transporter ATP-binding protein MA_0394 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q0AU85 1.01e-27 112 30 9 269 3 metN Methionine import ATP-binding protein MetN Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
Q043Y8 1.03e-27 112 31 7 247 3 metN Methionine import ATP-binding protein MetN Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
P46920 1.05e-27 113 32 4 227 1 opuAA Glycine betaine transport ATP-binding protein OpuAA Bacillus subtilis (strain 168)
Q1GAN9 1.06e-27 112 29 5 256 3 metN Methionine import ATP-binding protein MetN Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
Q04B25 1.09e-27 112 29 5 256 3 metN Methionine import ATP-binding protein MetN Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q0SQH5 1.11e-27 110 31 7 238 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Clostridium perfringens (strain SM101 / Type A)
Q839D5 1.23e-27 110 30 6 242 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Enterococcus faecalis (strain ATCC 700802 / V583)
Q03P57 1.53e-27 112 29 5 252 3 metN Methionine import ATP-binding protein MetN Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q03PF2 1.64e-27 112 29 6 244 3 potA Spermidine/putrescine import ATP-binding protein PotA Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q5YRD1 2.11e-27 111 31 8 240 3 metN Methionine import ATP-binding protein MetN Nocardia farcinica (strain IFM 10152)
Q8ZR89 2.27e-27 111 30 6 256 3 metN2 Methionine import ATP-binding protein MetN 2 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P31134 2.31e-27 111 34 7 250 1 potG Putrescine transport ATP-binding protein PotG Escherichia coli (strain K12)
Q67SV5 2.38e-27 110 30 6 241 3 metN Methionine import ATP-binding protein MetN Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q0P9X7 2.49e-27 108 30 7 240 3 peb1C Probable ABC transporter ATP-binding protein PEB1C Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q5PCG9 2.49e-27 110 30 6 256 3 metN2 Methionine import ATP-binding protein MetN 2 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q8Z8R5 2.74e-27 110 30 6 256 3 metN2 Methionine import ATP-binding protein MetN 2 Salmonella typhi
Q4QP85 2.86e-27 111 32 6 249 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Haemophilus influenzae (strain 86-028NP)
Q46Y69 2.92e-27 110 31 6 254 3 metN Methionine import ATP-binding protein MetN Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q8XNY7 2.94e-27 109 31 9 256 3 CPE0195 Putative ABC transporter ATP-binding protein CPE0195 Clostridium perfringens (strain 13 / Type A)
Q92LX3 2.99e-27 111 31 6 240 3 metN Methionine import ATP-binding protein MetN Rhizobium meliloti (strain 1021)
Q1LQF6 3.02e-27 110 30 7 269 3 metN Methionine import ATP-binding protein MetN Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q8XHV2 3.17e-27 109 31 7 238 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Clostridium perfringens (strain 13 / Type A)
Q0TMS7 3.17e-27 109 31 7 238 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q6D734 3.25e-27 110 31 7 258 3 fbpC1 Fe(3+) ions import ATP-binding protein FbpC 1 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q5E715 3.56e-27 110 30 7 246 3 metN Methionine import ATP-binding protein MetN Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q7CHF8 3.76e-27 110 32 7 262 3 metN2 Methionine import ATP-binding protein MetN 2 Yersinia pestis
Q1C970 3.76e-27 110 32 7 262 3 metN2 Methionine import ATP-binding protein MetN 2 Yersinia pestis bv. Antiqua (strain Antiqua)
Q66CQ3 3.76e-27 110 32 7 262 3 metN1 Methionine import ATP-binding protein MetN 1 Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1CG91 3.76e-27 110 32 7 262 3 metN1 Methionine import ATP-binding protein MetN 1 Yersinia pestis bv. Antiqua (strain Nepal516)
Q2K8C8 3.81e-27 110 33 8 257 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q6LKD4 4.44e-27 110 31 5 219 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Photobacterium profundum (strain SS9)
Q6N798 4.63e-27 110 32 7 251 3 metN2 Methionine import ATP-binding protein MetN 2 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
P45022 4.99e-27 108 28 6 255 3 HI_1078 Probable amino-acid ABC transporter ATP-binding protein HI_1078 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P40735 5.17e-27 108 33 6 230 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus subtilis (strain 168)
Q45460 5.3e-27 110 29 5 248 2 opuBA Choline transport ATP-binding protein OpuBA Bacillus subtilis (strain 168)
Q8Z0H0 5.99e-27 110 33 6 237 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q57S53 7.28e-27 109 30 6 256 3 metN2 Methionine import ATP-binding protein MetN 2 Salmonella choleraesuis (strain SC-B67)
Q9CM80 7.42e-27 110 31 5 238 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Pasteurella multocida (strain Pm70)
Q97JB8 7.62e-27 108 28 6 254 3 CA_C1368 Putative ABC transporter ATP-binding protein CA_C1368 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
A1VZQ5 7.98e-27 107 29 7 240 3 peb1C Probable ABC transporter ATP-binding protein PEB1C Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Q9KTJ5 8.52e-27 109 28 7 257 3 metN Methionine import ATP-binding protein MetN Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A3CRB9 8.65e-27 108 33 8 229 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus sanguinis (strain SK36)
Q57293 9.74e-27 109 31 5 232 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Actinobacillus pleuropneumoniae
Q82WT5 1.03e-26 109 29 7 275 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q49ZE0 1.15e-26 107 33 5 215 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
P36636 1.17e-26 108 28 8 277 2 sapD Peptide transport system ATP-binding protein SapD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q669P3 1.3e-26 106 32 7 230 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Yersinia pseudotuberculosis serotype I (strain IP32953)
Q02QT1 1.32e-26 107 36 6 211 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Pseudomonas aeruginosa (strain UCBPP-PA14)
Q6HPN0 1.32e-26 107 32 7 219 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q81VQ2 1.32e-26 107 32 7 219 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus anthracis
A0R8K8 1.32e-26 107 32 7 219 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus thuringiensis (strain Al Hakam)
P0C0E9 1.37e-26 107 32 8 239 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Streptococcus pyogenes
P0CZ29 1.37e-26 107 32 8 239 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M3 (strain SSI-1)
A2RH11 1.37e-26 107 32 8 239 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J449 1.37e-26 107 32 8 239 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JEC8 1.37e-26 107 32 8 239 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q7CMM7 1.37e-26 107 32 8 239 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5X9B5 1.37e-26 107 32 8 239 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0CZ28 1.37e-26 107 32 8 239 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q8ETV7 1.44e-26 107 33 8 233 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q6AE21 1.45e-26 108 29 7 253 3 metN Methionine import ATP-binding protein MetN Leifsonia xyli subsp. xyli (strain CTCB07)
Q48QM2 1.47e-26 107 32 8 239 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M28 (strain MGAS6180)
Q1JJC9 1.47e-26 107 32 8 239 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M12 (strain MGAS9429)
P0C0E8 1.47e-26 107 32 8 239 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M1
Q1CI46 1.48e-26 106 32 7 230 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZFR4 1.48e-26 106 32 7 230 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Yersinia pestis
Q1C6Q8 1.48e-26 106 32 7 230 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Yersinia pestis bv. Antiqua (strain Antiqua)
A3CVD3 1.62e-26 107 28 3 238 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1)
P37774 1.76e-26 106 31 9 263 1 tcyN L-cystine transport system ATP-binding protein TcyN Escherichia coli (strain K12)
Q2NRN5 1.79e-26 108 32 6 232 3 metN Methionine import ATP-binding protein MetN Sodalis glossinidius (strain morsitans)
Q2YAD6 1.81e-26 108 30 7 243 3 potA Spermidine/putrescine import ATP-binding protein PotA Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q71WH7 1.89e-26 107 33 7 236 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Listeria monocytogenes serotype 4b (strain F2365)
Q927N8 1.93e-26 107 32 7 236 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q63E84 2.18e-26 108 31 4 213 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacillus cereus (strain ZK / E33L)
Q73BM0 2.18e-26 108 31 4 213 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacillus cereus (strain ATCC 10987 / NRS 248)
A0RBB0 2.18e-26 108 31 4 213 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacillus thuringiensis (strain Al Hakam)
O83658 2.33e-26 108 32 5 223 3 potA Spermidine/putrescine import ATP-binding protein PotA Treponema pallidum (strain Nichols)
Q6HLQ9 2.34e-26 108 31 4 213 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q1J982 2.35e-26 107 32 8 239 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q0SZJ4 2.6e-26 106 30 8 248 3 nikD Nickel import ATP-binding protein NikD Shigella flexneri serotype 5b (strain 8401)
Q83J78 2.77e-26 106 30 8 248 3 nikD Nickel import ATP-binding protein NikD Shigella flexneri
Q8RI39 2.89e-26 108 32 8 240 3 potA Spermidine/putrescine import ATP-binding protein PotA Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q4L885 2.94e-26 106 32 5 206 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus haemolyticus (strain JCSC1435)
P45247 3.11e-26 105 31 8 236 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q4QKQ9 3.11e-26 105 31 8 236 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Haemophilus influenzae (strain 86-028NP)
Q18CJ0 3.25e-26 106 31 8 241 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Clostridioides difficile (strain 630)
Q65P77 3.34e-26 106 33 6 230 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q04G50 3.76e-26 108 28 6 265 3 potA Spermidine/putrescine import ATP-binding protein PotA Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q4A5A5 3.79e-26 106 32 6 230 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasmopsis synoviae (strain 53)
Q8ELR4 3.84e-26 108 29 7 257 3 potA Spermidine/putrescine import ATP-binding protein PotA Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q6G2E2 4.1e-26 107 28 7 267 3 metN Methionine import ATP-binding protein MetN Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
P44531 4.2e-26 107 30 5 238 3 fbpC1 Fe(3+) ions import ATP-binding protein FbpC 1 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q0AGF4 4.23e-26 108 30 6 259 3 potA Spermidine/putrescine import ATP-binding protein PotA Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q65UE1 4.3e-26 108 29 5 239 3 potA Spermidine/putrescine import ATP-binding protein PotA Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
O26236 4.33e-26 106 30 6 232 3 MTH_133 Putative ABC transporter ATP-binding protein MTH_133 Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q63H62 4.38e-26 106 32 7 219 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus cereus (strain ZK / E33L)
Q1WVG9 4.45e-26 107 26 6 259 3 metN Methionine import ATP-binding protein MetN Ligilactobacillus salivarius (strain UCC118)
P0AAH7 5.01e-26 107 29 9 275 3 sapD Peptide transport system ATP-binding protein SapD Shigella flexneri
P0AAH4 5.01e-26 107 29 9 275 1 sapD Putrescine export system ATP-binding protein SapD Escherichia coli (strain K12)
P0AAH5 5.01e-26 107 29 9 275 3 sapD Peptide transport system ATP-binding protein SapD Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AAH6 5.01e-26 107 29 9 275 3 sapD Peptide transport system ATP-binding protein SapD Escherichia coli O157:H7
Q82TL6 5.2e-26 107 29 6 253 3 potA Spermidine/putrescine import ATP-binding protein PotA Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q67JX3 5.33e-26 106 34 7 218 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q04EY5 5.41e-26 106 30 6 229 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q73F67 5.62e-26 106 32 7 219 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus cereus (strain ATCC 10987 / NRS 248)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_10765
Feature type CDS
Gene sapF
Product putrescine export ABC transporter ATP-binding protein SapF
Location 45191 - 46000 (strand: -1)
Length 810 (nucleotides) / 269 (amino acids)
In genomic island -

Contig

Accession ZDB_688
Length 181491 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1077
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00005 ABC transporter

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4167 Defense mechanisms (V) V ABC-type antimicrobial peptide export system, ATPase component SapF

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K19230 cationic peptide transport system ATP-binding protein Cationic antimicrobial peptide (CAMP) resistance
ABC transporters
-

Protein Sequence

MPGPLLEVKNLSKTFRYRDGFFRRHQLEAVKPVSFTLQPGQTLAITGANGSGKSTLARMLSGMIEPSGGEILIDKHKLTFGDYSYRSQRIRMIFQDSATSLNPRQRTGQILELPLMLNTDLDAAGRRLRINATLRQVGLLPDHADYYPHMLASGQKQRVALARALILQPEVIVADEALASLDMSLRSQIINLILELQETQKIAYIYVTQHLGMAKHVSDQILVMHNGEVVERGNTAEVLASPLHDVTRRLITSHFGEALSAEAWRQDVD

Flanking regions ( +/- flanking 50bp)

AAAAACCGCAGTTTTGCCTGTCACTTCCCGCTGAATATGGAGGATGTGTAATGCCCGGTCCGCTGCTGGAAGTCAAAAACCTGAGCAAAACCTTCCGTTACCGGGATGGTTTTTTCCGCCGTCATCAGCTTGAGGCGGTCAAACCGGTCAGTTTTACACTGCAACCCGGCCAGACACTCGCTATTACCGGCGCAAACGGCTCCGGCAAATCCACCCTCGCGCGGATGTTATCCGGGATGATCGAGCCGAGCGGCGGGGAAATCCTGATCGACAAACACAAACTGACGTTTGGTGATTACAGCTACCGCAGCCAGCGCATCCGCATGATATTCCAGGATTCAGCCACCTCGCTTAATCCGCGCCAGCGCACGGGGCAAATCCTTGAGCTGCCGCTGATGCTCAATACAGATCTCGATGCTGCCGGACGCCGTCTGCGCATTAACGCAACACTGCGCCAGGTGGGTCTGCTGCCGGATCACGCGGATTACTATCCTCACATGCTGGCTTCCGGACAGAAACAGCGTGTGGCCCTCGCCCGCGCCCTGATTCTGCAGCCGGAAGTGATTGTGGCGGATGAAGCGCTCGCCTCTCTGGATATGTCATTACGTTCACAGATCATAAATCTGATCCTTGAACTCCAGGAAACGCAAAAAATTGCCTATATTTATGTCACACAGCATCTGGGCATGGCAAAACATGTCAGTGACCAGATACTGGTGATGCACAACGGTGAAGTTGTCGAGCGCGGTAACACTGCCGAGGTACTGGCATCCCCGCTGCACGATGTCACACGCCGCCTTATCACCAGCCACTTTGGTGAAGCACTGTCCGCCGAAGCCTGGCGCCAGGATGTGGATTAACTGCCGGTATTCTGATAATTCAGGCCGGTTACATCTCAATTTCCGGTAAC