Homologs in group_3813

Help

1 homologs were identified in 1 genome with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_11640 EHELCC_11640 100.0 Morganella morganii S2 - hypothetical protein

Distribution of the homologs in the orthogroup group_3813

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3813

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_10455
Feature type CDS
Gene -
Product hypothetical protein
Location 172840 - 172935 (strand: -1)
Length 96 (nucleotides) / 31 (amino acids)
In genomic island -

Contig

Accession ZDB_687
Length 188522 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3813
Orthogroup size 2
N. genomes 2

Actions

Genomic region

Protein Sequence

MYFVINTFYISHEDKLFNIFSIHAKMPVIKL

Flanking regions ( +/- flanking 50bp)

AGTTTTTTTACTTATTCTGTTGCCTCAGATCGCAAAACGGACGATTTGTGATGTATTTTGTTATTAATACTTTTTATATTTCACATGAAGATAAATTGTTTAACATTTTTAGCATTCACGCAAAAATGCCGGTTATTAAACTATGACAGCAATCGGTTTCGTGAATACTTTTTCATCCTACTGAGGGAATTATCAT