Homologs in group_1890

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_13855 FBDBKF_13855 100.0 Morganella morganii S1 terB Tellurite resistance protein TerB
EHELCC_11525 EHELCC_11525 100.0 Morganella morganii S2 terB Tellurite resistance protein TerB
NLDBIP_11870 NLDBIP_11870 100.0 Morganella morganii S4 terB Tellurite resistance protein TerB
LHKJJB_11730 LHKJJB_11730 100.0 Morganella morganii S3 terB Tellurite resistance protein TerB
F4V73_RS12720 F4V73_RS12720 92.1 Morganella psychrotolerans - tellurite resistance TerB family protein
PMI_RS11805 PMI_RS11805 76.8 Proteus mirabilis HI4320 - TerB family tellurite resistance protein

Distribution of the homologs in the orthogroup group_1890

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1890

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P18779 2.7e-67 202 80 0 119 4 terB Tellurium resistance protein TerB Alcaligenes sp.

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_10340
Feature type CDS
Gene terB
Product Tellurite resistance protein TerB
Location 150576 - 151031 (strand: -1)
Length 456 (nucleotides) / 151 (amino acids)
In genomic island -

Contig

Accession ZDB_687
Length 188522 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1890
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF05099 Tellurite resistance protein TerB

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3793 Inorganic ion transport and metabolism (P) P Tellurite resistance protein TerB

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K05793 tellurite resistance protein TerB - -

Protein Sequence

MSILNRVKSAFNSGREELTKQVSRFRNRKFMEGTIAVCARIAVSSDGVSAEEKQKMIGFLKSSEELKVFETEEVITFFNKLVTSFDFDMEIGKGETMKYILALKDQPEAAQLAVRVGIAVAKSDGNFDQDEQKAVKEIAAALGFDPAEFGL

Flanking regions ( +/- flanking 50bp)

GGGTTTCCGCTGGAAAGCCGGCTCGAAATAATTTAAGTGAGGATACAGCAATGAGTATACTTAACCGGGTCAAAAGTGCGTTTAATTCAGGCCGCGAAGAGCTGACAAAACAGGTCAGCCGTTTCAGAAACCGTAAGTTTATGGAAGGTACAATCGCTGTCTGTGCCCGCATTGCGGTTTCCAGTGACGGGGTCAGTGCGGAAGAAAAACAGAAAATGATCGGTTTTCTGAAATCCTCTGAAGAACTGAAAGTATTTGAAACCGAAGAAGTCATTACATTTTTCAACAAATTGGTCACCAGTTTCGATTTCGACATGGAAATCGGCAAAGGTGAAACCATGAAATATATCCTGGCGCTGAAGGATCAGCCGGAAGCAGCGCAGTTAGCGGTGCGTGTCGGGATTGCAGTCGCGAAGAGTGACGGTAACTTCGATCAGGATGAGCAGAAAGCAGTAAAAGAGATCGCCGCTGCTCTGGGGTTTGACCCGGCAGAGTTCGGTCTCTGATTTTTATACCTAAGGGTTAATTATGGAATCAACACATATCGGTTTTCCGA