Homologs in group_1183

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_06820 FBDBKF_06820 100.0 Morganella morganii S1 yohJ Putative effector of murein hydrolase LrgA, UPF0299 family
EHELCC_04150 EHELCC_04150 100.0 Morganella morganii S2 yohJ Putative effector of murein hydrolase LrgA, UPF0299 family
NLDBIP_04150 NLDBIP_04150 100.0 Morganella morganii S4 yohJ Putative effector of murein hydrolase LrgA, UPF0299 family
LHKJJB_09980 LHKJJB_09980 100.0 Morganella morganii S3 yohJ Putative effector of murein hydrolase LrgA, UPF0299 family
F4V73_RS00960 F4V73_RS00960 94.6 Morganella psychrotolerans - CidA/LrgA family protein
PMI_RS03180 PMI_RS03180 59.4 Proteus mirabilis HI4320 - CidA/LrgA family protein

Distribution of the homologs in the orthogroup group_1183

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1183

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
A1JTY1 2.56e-48 155 48 1 143 3 YE2790 UPF0299 membrane protein YE2790 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
C6DDT0 3.73e-47 152 57 0 114 3 PC1_1498 UPF0299 membrane protein PC1_1498 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q7N6K1 5.31e-47 152 56 0 134 3 plu1549 UPF0299 membrane protein plu1549 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q6D3B6 7.67e-47 151 54 0 120 3 ECA2828 UPF0299 membrane protein ECA2828 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A8GC34 4.28e-45 147 52 1 126 3 Spro_1570 UPF0299 membrane protein Spro_1570 Serratia proteamaculans (strain 568)
B7LVA1 1.6e-44 145 49 0 131 3 yohJ UPF0299 membrane protein YohJ Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1C9U5 2.69e-44 145 56 1 120 3 YPA_0809 UPF0299 membrane protein YPA_0809 Yersinia pestis bv. Antiqua (strain Antiqua)
A9QZM5 2.69e-44 145 56 1 120 3 YpAngola_A3025 UPF0299 membrane protein YpAngola_A3025 Yersinia pestis bv. Antiqua (strain Angola)
B1JPZ3 2.69e-44 145 56 1 120 3 YPK_2559 UPF0299 membrane protein YPK_2559 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q1CGT7 2.69e-44 145 56 1 120 3 YPN_2465 UPF0299 membrane protein YPN_2465 Yersinia pestis bv. Antiqua (strain Nepal516)
A7FJK1 2.69e-44 145 56 1 120 3 YpsIP31758_2460 UPF0299 membrane protein YpsIP31758_2460 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
B2JZJ8 2.69e-44 145 56 1 120 3 YPTS_1639 UPF0299 membrane protein YPTS_1639 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q66C77 2.69e-44 145 56 1 120 3 YPTB1529 UPF0299 membrane protein YPTB1529 Yersinia pseudotuberculosis serotype I (strain IP32953)
Q8D074 2.69e-44 145 56 1 120 3 YPO1514 UPF0299 membrane protein YPO1514/y2654/YP_1404 Yersinia pestis
A4TKN5 2.69e-44 145 56 1 120 3 YPDSF_1460 UPF0299 membrane protein YPDSF_1460 Yersinia pestis (strain Pestoides F)
A4WCH9 9.6e-44 143 51 0 125 3 Ent638_2744 UPF0299 membrane protein Ent638_2744 Enterobacter sp. (strain 638)
Q3Z064 1.23e-43 143 51 0 124 3 yohJ UPF0299 membrane protein YohJ Shigella sonnei (strain Ss046)
P60634 1.23e-43 143 51 0 124 3 yohJ UPF0299 membrane protein YohJ Shigella flexneri
Q322V1 1.23e-43 143 51 0 124 3 yohJ UPF0299 membrane protein YohJ Shigella boydii serotype 4 (strain Sb227)
B1LKN8 1.23e-43 143 51 0 124 3 yohJ UPF0299 membrane protein YohJ Escherichia coli (strain SMS-3-5 / SECEC)
B6I8J1 1.23e-43 143 51 0 124 3 yohJ UPF0299 membrane protein YohJ Escherichia coli (strain SE11)
B7NCH0 1.23e-43 143 51 0 124 3 yohJ UPF0299 membrane protein YohJ Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P60632 1.23e-43 143 51 0 124 1 yohJ UPF0299 membrane protein YohJ Escherichia coli (strain K12)
B1IYC8 1.23e-43 143 51 0 124 3 yohJ UPF0299 membrane protein YohJ Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P60633 1.23e-43 143 51 0 124 3 yohJ UPF0299 membrane protein YohJ Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TFV0 1.23e-43 143 51 0 124 3 yohJ UPF0299 membrane protein YohJ Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AD02 1.23e-43 143 51 0 124 3 yohJ UPF0299 membrane protein YohJ Escherichia coli O1:K1 / APEC
A8A203 1.23e-43 143 51 0 124 3 yohJ UPF0299 membrane protein YohJ Escherichia coli O9:H4 (strain HS)
B1X7N0 1.23e-43 143 51 0 124 3 yohJ UPF0299 membrane protein YohJ Escherichia coli (strain K12 / DH10B)
C4ZSM1 1.23e-43 143 51 0 124 3 yohJ UPF0299 membrane protein YohJ Escherichia coli (strain K12 / MC4100 / BW2952)
B7M4Y6 1.23e-43 143 51 0 124 3 yohJ UPF0299 membrane protein YohJ Escherichia coli O8 (strain IAI1)
B7MXF3 1.23e-43 143 51 0 124 3 yohJ UPF0299 membrane protein YohJ Escherichia coli O81 (strain ED1a)
B7NMA6 1.23e-43 143 51 0 124 3 yohJ UPF0299 membrane protein YohJ Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7LA07 1.23e-43 143 51 0 124 3 yohJ UPF0299 membrane protein YohJ Escherichia coli (strain 55989 / EAEC)
B7MF53 1.23e-43 143 51 0 124 3 yohJ UPF0299 membrane protein YohJ Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UFF7 1.23e-43 143 51 0 124 3 yohJ UPF0299 membrane protein YohJ Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B5YW73 2.13e-43 142 50 0 124 3 yohJ UPF0299 membrane protein YohJ Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X653 2.13e-43 142 50 0 124 3 yohJ UPF0299 membrane protein YohJ Escherichia coli O157:H7
A7ZNW3 2.13e-43 142 50 0 124 3 yohJ UPF0299 membrane protein YohJ Escherichia coli O139:H28 (strain E24377A / ETEC)
Q32EM1 7.65e-43 141 50 0 124 3 yohJ UPF0299 membrane protein YohJ Shigella dysenteriae serotype 1 (strain Sd197)
A8AE89 1.22e-42 140 55 0 111 3 CKO_00648 UPF0299 membrane protein CKO_00648 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B2TVV4 1.25e-42 140 50 0 124 3 yohJ UPF0299 membrane protein YohJ Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q0T2Y2 2.23e-42 140 50 0 124 3 yohJ UPF0299 membrane protein YohJ Shigella flexneri serotype 5b (strain 8401)
B5XP67 3.48e-41 137 53 1 126 3 KPK_1586 UPF0299 membrane protein KPK_1586 Klebsiella pneumoniae (strain 342)
A6TBM9 5.08e-40 134 50 0 124 3 KPN78578_25390 UPF0299 membrane protein KPN78578_25390 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A9MKS7 1.48e-39 132 50 0 124 3 yohJ UPF0299 membrane protein YohJ Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
P60636 3.54e-39 132 51 0 120 3 yohJ UPF0299 membrane protein YohJ Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P60635 3.54e-39 132 51 0 120 3 yohJ UPF0299 membrane protein YohJ Salmonella typhi
B4TNN8 3.54e-39 132 51 0 120 3 yohJ UPF0299 membrane protein YohJ Salmonella schwarzengrund (strain CVM19633)
B5BE54 3.54e-39 132 51 0 120 3 yohJ UPF0299 membrane protein YohJ Salmonella paratyphi A (strain AKU_12601)
C0Q0V6 3.54e-39 132 51 0 120 3 yohJ UPF0299 membrane protein YohJ Salmonella paratyphi C (strain RKS4594)
A9N6L5 3.54e-39 132 51 0 120 3 yohJ UPF0299 membrane protein YohJ Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PE66 3.54e-39 132 51 0 120 3 yohJ UPF0299 membrane protein YohJ Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SY13 3.54e-39 132 51 0 120 3 yohJ UPF0299 membrane protein YohJ Salmonella newport (strain SL254)
B4TAK3 3.54e-39 132 51 0 120 3 yohJ UPF0299 membrane protein YohJ Salmonella heidelberg (strain SL476)
B5RC20 3.54e-39 132 51 0 120 3 yohJ UPF0299 membrane protein YohJ Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R151 3.54e-39 132 51 0 120 3 yohJ UPF0299 membrane protein YohJ Salmonella enteritidis PT4 (strain P125109)
B5FMZ7 3.54e-39 132 51 0 120 3 yohJ UPF0299 membrane protein YohJ Salmonella dublin (strain CT_02021853)
B5EYN1 3.54e-39 132 51 0 120 3 yohJ UPF0299 membrane protein YohJ Salmonella agona (strain SL483)
B2VIF5 9.05e-31 110 46 0 122 3 ETA_12980 UPF0299 membrane protein ETA_12980 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A5F1V9 8.1e-21 85 38 1 120 3 VC0395_A0854 UPF0299 membrane protein VC0395_A0854/VC395_1352 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q9KSM3 8.1e-21 85 38 1 120 3 VC_1233 UPF0299 membrane protein VC_1233 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
C3LLS9 8.1e-21 85 38 1 120 3 VCM66_1188 UPF0299 membrane protein VCM66_1188 Vibrio cholerae serotype O1 (strain M66-2)
A7MVI0 3.4e-18 78 39 0 97 3 VIBHAR_02118 UPF0299 membrane protein VIBHAR_02118 Vibrio campbellii (strain ATCC BAA-1116)
Q7MLF6 4.73e-18 77 38 0 99 3 VV1471 UPF0299 membrane protein VV1471 Vibrio vulnificus (strain YJ016)
Q87Q50 5.76e-17 75 40 1 89 3 VP1300 UPF0299 membrane protein VP1300 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q65T32 1.96e-16 74 39 0 108 3 MS1271 UPF0299 membrane protein MS1271 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
P39591 3.83e-15 70 32 0 96 3 cidA Holin-like protein CidA Bacillus subtilis (strain 168)
A7ZA61 7.68e-15 69 31 0 97 3 cidA Holin-like protein CidA Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q6HFD1 5.59e-14 67 29 0 117 3 cidA Holin-like protein CidA Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q637F8 5.59e-14 67 29 0 117 3 cidA Holin-like protein CidA Bacillus cereus (strain ZK / E33L)
B9IUJ0 5.59e-14 67 29 0 117 3 cidA Holin-like protein CidA Bacillus cereus (strain Q1)
B7HKL5 5.59e-14 67 29 0 117 3 cidA Holin-like protein CidA Bacillus cereus (strain AH187)
C1ENB1 5.59e-14 67 29 0 117 3 cidA Holin-like protein CidA Bacillus cereus (strain 03BB102)
Q733F5 5.59e-14 67 29 0 117 3 cidA Holin-like protein CidA Bacillus cereus (strain ATCC 10987 / NRS 248)
Q81Y27 9.84e-14 66 29 0 117 3 cidA1 Holin-like protein CidA 1 Bacillus anthracis
Q65DJ4 1.06e-13 66 32 1 105 3 cidA Holin-like protein CidA Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
A7GR09 1.77e-13 65 28 0 117 3 cidA Holin-like protein CidA Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q9CME9 1.93e-13 66 38 1 121 3 PM0880 UPF0299 membrane protein PM0880 Pasteurella multocida (strain Pm70)
B7HCE7 1.97e-13 65 28 0 114 3 cidA Holin-like protein CidA Bacillus cereus (strain B4264)
Q81AB0 1.97e-13 65 28 0 114 3 cidA1 Holin-like protein CidA 1 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
P45145 2.37e-13 66 31 1 126 3 HI_1297 UPF0299 membrane protein HI_1297 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q4QK50 2.4e-13 66 31 1 126 3 NTHI1827 UPF0299 membrane protein NTHI1827 Haemophilus influenzae (strain 86-028NP)
A5UF21 2.4e-13 66 31 1 126 3 CGSHiGG_01475 UPF0299 membrane protein CGSHiGG_01475 Haemophilus influenzae (strain PittGG)
Q8NYH2 2.67e-12 63 28 1 146 3 lrgA Antiholin-like protein LrgA Staphylococcus aureus (strain MW2)
Q6GCL0 1.59e-11 61 27 1 146 3 lrgA Antiholin-like protein LrgA Staphylococcus aureus (strain MSSA476)
A5UBU9 1.79e-11 61 34 0 108 3 CGSHiEE_04225 UPF0299 membrane protein CGSHiEE_04225 Haemophilus influenzae (strain PittEE)
A5IPD1 1.99e-11 61 27 1 146 3 lrgA Antiholin-like protein LrgA Staphylococcus aureus (strain JH9)
A6TY47 1.99e-11 61 27 1 146 3 lrgA Antiholin-like protein LrgA Staphylococcus aureus (strain JH1)
B7JIF6 2.08e-11 61 29 1 125 3 lrgA Antiholin-like protein LrgA Bacillus cereus (strain AH820)
P60650 2.64e-11 60 27 1 146 3 lrgA Antiholin-like protein LrgA Staphylococcus aureus (strain N315)
P60649 2.64e-11 60 27 1 146 3 lrgA Antiholin-like protein LrgA Staphylococcus aureus (strain Mu50 / ATCC 700699)
A7WXS6 2.64e-11 60 27 1 146 3 lrgA Antiholin-like protein LrgA Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q6HAJ6 1.12e-10 59 29 1 125 3 lrgA Antiholin-like protein LrgA Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q630G3 1.12e-10 59 29 1 125 3 lrgA Antiholin-like protein LrgA Bacillus cereus (strain ZK / E33L)
B7HGA2 1.12e-10 59 29 1 125 3 lrgA Antiholin-like protein LrgA Bacillus cereus (strain B4264)
C1ER34 1.12e-10 59 29 1 125 3 lrgA Antiholin-like protein LrgA Bacillus cereus (strain 03BB102)
B7IRX2 1.12e-10 59 29 1 125 3 lrgA Antiholin-like protein LrgA Bacillus cereus (strain G9842)
Q81JL4 1.12e-10 59 29 1 125 3 lrgA Antiholin-like protein LrgA Bacillus anthracis
C3LGP8 1.12e-10 59 29 1 125 3 lrgA Antiholin-like protein LrgA Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P2J7 1.12e-10 59 29 1 125 3 lrgA Antiholin-like protein LrgA Bacillus anthracis (strain A0248)
A9VTH7 1.17e-10 59 29 1 127 3 lrgA Antiholin-like protein LrgA Bacillus mycoides (strain KBAB4)
B9ISZ4 1.67e-10 58 29 0 122 3 lrgA Antiholin-like protein LrgA Bacillus cereus (strain Q1)
B7HZC4 1.67e-10 58 29 0 122 3 lrgA Antiholin-like protein LrgA Bacillus cereus (strain AH187)
A8Z0M5 1.75e-10 58 26 1 146 3 lrgA Antiholin-like protein LrgA Staphylococcus aureus (strain USA300 / TCH1516)
Q6GK50 1.75e-10 58 26 1 146 3 lrgA Antiholin-like protein LrgA Staphylococcus aureus (strain MRSA252)
A6QDN6 1.75e-10 58 26 1 146 3 lrgA Antiholin-like protein LrgA Staphylococcus aureus (strain Newman)
Q5HJB4 1.75e-10 58 26 1 146 3 lrgA Antiholin-like protein LrgA Staphylococcus aureus (strain COL)
Q2YV66 1.75e-10 58 26 1 146 3 lrgA Antiholin-like protein LrgA Staphylococcus aureus (strain bovine RF122 / ET3-1)
P72358 1.75e-10 58 26 1 146 1 lrgA Antiholin-like protein LrgA Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FK08 1.75e-10 58 26 1 146 3 lrgA Antiholin-like protein LrgA Staphylococcus aureus (strain USA300)
Q814J2 2.7e-10 58 26 1 138 3 lrgA Antiholin-like protein LrgA Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q8CR38 2.38e-09 55 29 2 124 3 cidA Holin-like protein CidA Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HL70 2.38e-09 55 29 2 124 3 cidA Holin-like protein CidA Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q81WT3 4.92e-08 51 29 0 102 3 cidA2 Holin-like protein CidA 2 Bacillus anthracis
Q6GDQ7 1.19e-07 50 30 2 112 3 cidA Holin-like protein CidA Staphylococcus aureus (strain MRSA252)
P60648 1.21e-07 50 30 2 114 3 cidA Holin-like protein CidA Staphylococcus aureus (strain MW2)
A8Z3D9 1.21e-07 50 30 2 114 3 cidA Holin-like protein CidA Staphylococcus aureus (strain USA300 / TCH1516)
Q6G6D3 1.21e-07 50 30 2 114 3 cidA Holin-like protein CidA Staphylococcus aureus (strain MSSA476)
P60646 1.21e-07 50 30 2 114 3 cidA Holin-like protein CidA Staphylococcus aureus (strain N315)
P60645 1.21e-07 50 30 2 114 3 cidA Holin-like protein CidA Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QK30 1.21e-07 50 30 2 114 3 cidA Holin-like protein CidA Staphylococcus aureus (strain Newman)
Q5HD10 1.21e-07 50 30 2 114 3 cidA Holin-like protein CidA Staphylococcus aureus (strain COL)
A5IVW8 1.21e-07 50 30 2 114 3 cidA Holin-like protein CidA Staphylococcus aureus (strain JH9)
P60647 1.21e-07 50 30 2 114 1 cidA Holin-like protein CidA Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FDW5 1.21e-07 50 30 2 114 3 cidA Holin-like protein CidA Staphylococcus aureus (strain USA300)
A6U4S2 1.21e-07 50 30 2 114 3 cidA Holin-like protein CidA Staphylococcus aureus (strain JH1)
A7X6P6 1.21e-07 50 30 2 114 3 cidA Holin-like protein CidA Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q81A38 1.14e-06 48 28 0 102 3 cidA2 Holin-like protein CidA 2 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q8CN54 1.66e-05 45 32 0 76 3 lrgA Antiholin-like protein LrgA Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HLG1 1.8e-05 45 32 0 76 3 lrgA Antiholin-like protein LrgA Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_08995
Feature type CDS
Gene yohJ
Product Putative effector of murein hydrolase LrgA, UPF0299 family
Location 32209 - 32661 (strand: -1)
Length 453 (nucleotides) / 150 (amino acids)

Contig

Accession ZDB_686
Length 191111 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1183
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF03788 LrgA family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1380 General function prediction only (R) R Putative effector of murein hydrolase LrgA, UPF0299 family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K06518 holin-like protein - -

Protein Sequence

MKPKQIAETGWRYLRAFLILYLCLFAGNIIAVLLPFSVPGSIVGMLLLFVLLALQIVPAHWVQPGCTLLMKNMTMLFLPIGIGVMNYYDTLSAQLLPILIACVVSTFIAMCAVALSSEFIHRRHVPVPEQQEADAVAAAEHTEQQEKRKC

Flanking regions ( +/- flanking 50bp)

TAAAAAGTTAATTGTATGATGAATAAGTTCATCCAAGAAGGAACATTATCATGAAACCAAAACAGATAGCGGAAACCGGCTGGCGCTATCTCCGGGCATTTCTGATCCTGTATCTGTGCCTGTTTGCCGGCAATATTATCGCGGTGTTACTGCCGTTTTCCGTCCCGGGCAGCATCGTTGGCATGCTGCTGCTTTTTGTGCTGCTCGCACTGCAGATTGTTCCGGCGCACTGGGTTCAGCCCGGCTGTACCTTATTAATGAAAAACATGACGATGTTATTTCTGCCGATCGGTATCGGTGTGATGAACTATTACGATACCCTCAGCGCCCAGCTGCTGCCGATCCTCATCGCCTGTGTCGTCAGTACCTTTATCGCCATGTGTGCTGTGGCGCTGAGTTCTGAATTTATTCACCGCCGCCATGTTCCGGTTCCGGAACAACAGGAAGCCGATGCGGTTGCCGCAGCAGAACACACCGAACAACAAGAGAAACGCAAATGTTAACGCATATCTGGTGGTCGCTCCCGCTTACCATCGGCGTCTATTTTCTCGCC