Homologs in group_3244

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_04855 FBDBKF_04855 100.0 Morganella morganii S1 - hypothetical protein
EHELCC_06145 EHELCC_06145 100.0 Morganella morganii S2 - hypothetical protein
NLDBIP_06465 NLDBIP_06465 100.0 Morganella morganii S4 - hypothetical protein
LHKJJB_03345 LHKJJB_03345 100.0 Morganella morganii S3 - hypothetical protein

Distribution of the homologs in the orthogroup group_3244

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3244

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q56897 6.62e-06 43 58 0 31 3 None Transposase for insertion sequence element IS1328 Yersinia enterocolitica

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_06820
Feature type CDS
Gene -
Product hypothetical protein
Location 177145 - 177249 (strand: -1)
Length 105 (nucleotides) / 34 (amino acids)

Contig

Accession ZDB_683
Length 224720 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3244
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Protein Sequence

MQIITLIGIDIGKHTFHVLCQDKSGKALLHKTIE

Flanking regions ( +/- flanking 50bp)

CCCTGTGAGCGGTATGCTGACAGGGTGTTTTTCTTTCAGGAGAGGCCATCATGCAAATTATTACACTCATTGGTATCGATATCGGTAAACACACCTTTCATGTGCTTTGTCAGGATAAATCAGGCAAAGCGTTGTTGCACAAAACAATAGAGTGATTACAAAGCAAATCCCATGGTGCTTTGTTGTCCCGGTATCAGAAAAGAAA