Homologs in group_916

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_04285 FBDBKF_04285 100.0 Morganella morganii S1 mutT 8-oxo-dGTP diphosphatase MutT
EHELCC_05575 EHELCC_05575 100.0 Morganella morganii S2 mutT 8-oxo-dGTP diphosphatase MutT
NLDBIP_05895 NLDBIP_05895 100.0 Morganella morganii S4 mutT 8-oxo-dGTP diphosphatase MutT
LHKJJB_02775 LHKJJB_02775 100.0 Morganella morganii S3 mutT 8-oxo-dGTP diphosphatase MutT
F4V73_RS08730 F4V73_RS08730 83.8 Morganella psychrotolerans mutT 8-oxo-dGTP diphosphatase MutT
PMI_RS10130 PMI_RS10130 63.1 Proteus mirabilis HI4320 mutT 8-oxo-dGTP diphosphatase MutT

Distribution of the homologs in the orthogroup group_916

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_916

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P32090 6.65e-42 137 62 0 101 3 mutT 8-oxo-dGTP diphosphatase Proteus vulgaris
P08337 9.05e-42 137 52 0 125 1 mutT 8-oxo-dGTP diphosphatase Escherichia coli (strain K12)
P44932 6.06e-39 130 49 0 128 3 mutT 8-oxo-dGTP diphosphatase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P57298 5.15e-20 82 33 1 115 3 mutT 8-oxo-dGTP diphosphatase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
P77788 1.63e-17 76 40 1 105 1 nudG CTP pyrophosphohydrolase Escherichia coli (strain K12)
Q8K9U2 3.73e-13 64 31 1 98 3 mutT 8-oxo-dGTP diphosphatase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P9WIY1 2.92e-10 57 29 3 131 1 mutT2 Putative 8-oxo-dGTP diphosphatase 2 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WIY0 2.92e-10 57 29 3 131 3 mutT2 Putative 8-oxo-dGTP diphosphatase 2 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q9KU53 3.59e-09 55 38 3 81 3 rppH RNA pyrophosphohydrolase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
B6EMX5 8.1e-09 54 37 2 75 3 rppH RNA pyrophosphohydrolase Aliivibrio salmonicida (strain LFI1238)
B5F9U8 8.27e-09 54 33 4 99 3 rppH RNA pyrophosphohydrolase Aliivibrio fischeri (strain MJ11)
Q5E7P5 8.27e-09 54 33 4 99 3 rppH RNA pyrophosphohydrolase Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q6LUM5 9.32e-09 54 31 4 116 3 rppH RNA pyrophosphohydrolase Photobacterium profundum (strain SS9)
A7MXK7 9.64e-09 53 33 5 105 3 rppH RNA pyrophosphohydrolase Vibrio campbellii (strain ATCC BAA-1116)
Q87SA4 1.1e-08 53 33 5 105 3 rppH RNA pyrophosphohydrolase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B7VJ74 1.1e-08 53 31 5 122 3 rppH RNA pyrophosphohydrolase Vibrio atlanticus (strain LGP32)
A6Q441 1.59e-08 53 37 4 88 3 rppH RNA pyrophosphohydrolase Nitratiruptor sp. (strain SB155-2)
Q7MNP0 2.55e-08 52 32 5 105 3 rppH RNA pyrophosphohydrolase Vibrio vulnificus (strain YJ016)
Q8DER5 2.55e-08 52 32 5 105 3 rppH RNA pyrophosphohydrolase Vibrio vulnificus (strain CMCP6)
Q5HVI9 3.62e-08 52 37 3 81 3 rppH RNA pyrophosphohydrolase Campylobacter jejuni (strain RM1221)
A1VYU1 3.62e-08 52 37 3 81 3 rppH RNA pyrophosphohydrolase Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
A8FL05 3.62e-08 52 37 3 81 3 rppH RNA pyrophosphohydrolase Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
Q3IDL9 3.63e-08 52 37 2 75 3 rppH RNA pyrophosphohydrolase Pseudoalteromonas translucida (strain TAC 125)
Q9PHT5 4.84e-08 52 37 3 81 3 rppH RNA pyrophosphohydrolase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A7H3U9 5.78e-08 51 37 3 81 3 rppH RNA pyrophosphohydrolase Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
Q5R053 1.43e-07 50 40 2 75 3 rppH RNA pyrophosphohydrolase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
A4G8R1 2.15e-07 50 35 4 87 3 rppH RNA pyrophosphohydrolase Herminiimonas arsenicoxydans
C5CXX0 2.25e-07 50 34 4 87 3 rppH RNA pyrophosphohydrolase Variovorax paradoxus (strain S110)
Q21YZ6 3.39e-07 50 32 4 87 3 rppH RNA pyrophosphohydrolase Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
A1VK87 3.46e-07 50 34 4 87 3 rppH RNA pyrophosphohydrolase Polaromonas naphthalenivorans (strain CJ2)
Q7N8U7 3.58e-07 50 33 4 109 3 rppH RNA pyrophosphohydrolase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A9BP66 3.61e-07 50 34 4 87 3 rppH RNA pyrophosphohydrolase Delftia acidovorans (strain DSM 14801 / SPH-1)
B3R895 3.75e-07 50 35 4 87 3 rppH RNA pyrophosphohydrolase Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q9RVK2 3.79e-07 49 35 1 82 1 DR_1025 Nudix hydrolase DR_1025 Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
A1TTD1 3.87e-07 50 34 4 87 3 rppH RNA pyrophosphohydrolase Paracidovorax citrulli (strain AAC00-1)
A1W4B2 3.91e-07 50 34 4 87 3 rppH RNA pyrophosphohydrolase Acidovorax sp. (strain JS42)
B9MDZ9 3.99e-07 50 34 4 87 3 rppH RNA pyrophosphohydrolase Acidovorax ebreus (strain TPSY)
Q46X20 4.42e-07 50 35 4 87 3 rppH RNA pyrophosphohydrolase Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q0K6P9 4.44e-07 50 35 4 87 3 rppH RNA pyrophosphohydrolase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q8XVL3 4.64e-07 50 35 4 87 3 rppH RNA pyrophosphohydrolase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
B2JHD4 5.45e-07 50 36 4 87 3 rppH RNA pyrophosphohydrolase Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q0BIH5 5.45e-07 49 35 4 87 3 rppH RNA pyrophosphohydrolase Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B1YSV0 5.45e-07 49 35 4 87 3 rppH RNA pyrophosphohydrolase Burkholderia ambifaria (strain MC40-6)
B2UCV0 5.63e-07 50 35 4 87 3 rppH RNA pyrophosphohydrolase Ralstonia pickettii (strain 12J)
A3NDS3 6.09e-07 49 35 4 87 3 rppH RNA pyrophosphohydrolase Burkholderia pseudomallei (strain 668)
Q63QM4 6.21e-07 49 35 4 87 3 rppH RNA pyrophosphohydrolase Burkholderia pseudomallei (strain K96243)
Q3JNG3 6.21e-07 49 35 4 87 3 rppH RNA pyrophosphohydrolase Burkholderia pseudomallei (strain 1710b)
A3NZI7 6.21e-07 49 35 4 87 3 rppH RNA pyrophosphohydrolase Burkholderia pseudomallei (strain 1106a)
A1V0N7 6.21e-07 49 35 4 87 3 rppH RNA pyrophosphohydrolase Burkholderia mallei (strain SAVP1)
Q62GV7 6.21e-07 49 35 4 87 3 rppH RNA pyrophosphohydrolase Burkholderia mallei (strain ATCC 23344)
A2S5R4 6.21e-07 49 35 4 87 3 rppH RNA pyrophosphohydrolase Burkholderia mallei (strain NCTC 10229)
A3MR94 6.21e-07 49 35 4 87 3 rppH RNA pyrophosphohydrolase Burkholderia mallei (strain NCTC 10247)
B4E5W7 6.31e-07 49 35 4 87 3 rppH RNA pyrophosphohydrolase Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
Q1BZD7 6.37e-07 49 35 4 87 3 rppH RNA pyrophosphohydrolase Burkholderia orbicola (strain AU 1054)
B1JVA4 6.37e-07 49 35 4 87 3 rppH RNA pyrophosphohydrolase Burkholderia orbicola (strain MC0-3)
A0K4B3 6.37e-07 49 35 4 87 3 rppH RNA pyrophosphohydrolase Burkholderia cenocepacia (strain HI2424)
A9AI57 6.42e-07 49 35 4 87 3 rppH RNA pyrophosphohydrolase Burkholderia multivorans (strain ATCC 17616 / 249)
A1WKI2 6.43e-07 49 33 4 87 3 rppH RNA pyrophosphohydrolase Verminephrobacter eiseniae (strain EF01-2)
Q2SZF7 6.6e-07 49 35 4 87 3 rppH RNA pyrophosphohydrolase Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
B2SFE8 6.81e-07 48 33 2 78 3 rppH RNA pyrophosphohydrolase Francisella tularensis subsp. mediasiatica (strain FSC147)
A4JBC1 7.24e-07 49 35 4 87 3 rppH RNA pyrophosphohydrolase Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q39JU4 7.24e-07 49 35 4 87 3 rppH RNA pyrophosphohydrolase Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
C4LD21 7.31e-07 48 33 4 99 3 rppH RNA pyrophosphohydrolase Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
B4F2G9 1.16e-06 48 33 4 99 3 rppH RNA pyrophosphohydrolase Proteus mirabilis (strain HI4320)
A6T2D2 1.17e-06 48 34 4 87 3 rppH RNA pyrophosphohydrolase Janthinobacterium sp. (strain Marseille)
B1XYW4 1.21e-06 48 34 4 87 3 rppH RNA pyrophosphohydrolase Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
A1K975 1.31e-06 48 32 5 105 3 rppH RNA pyrophosphohydrolase Azoarcus sp. (strain BH72)
A4SIW4 1.35e-06 48 31 4 99 3 rppH RNA pyrophosphohydrolase Aeromonas salmonicida (strain A449)
A0KG29 1.48e-06 48 31 4 99 3 rppH RNA pyrophosphohydrolase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A1SS92 1.58e-06 48 37 3 75 3 rppH RNA pyrophosphohydrolase Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q7VRF3 1.97e-06 47 34 2 78 3 rppH RNA pyrophosphohydrolase Blochmanniella floridana
Q2N9Y3 2.08e-06 47 35 5 108 3 rppH RNA pyrophosphohydrolase Erythrobacter litoralis (strain HTCC2594)
A4IWB3 2.14e-06 47 33 2 78 3 rppH RNA pyrophosphohydrolase Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NIB6 2.14e-06 47 33 2 78 3 rppH RNA pyrophosphohydrolase Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q0BKE0 2.14e-06 47 33 2 78 3 rppH RNA pyrophosphohydrolase Francisella tularensis subsp. holarctica (strain OSU18)
Q2A1P2 2.14e-06 47 33 2 78 3 rppH RNA pyrophosphohydrolase Francisella tularensis subsp. holarctica (strain LVS)
A7NEA4 2.14e-06 47 33 2 78 3 rppH RNA pyrophosphohydrolase Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
Q14JR9 2.14e-06 47 33 2 78 3 rppH RNA pyrophosphohydrolase Francisella tularensis subsp. tularensis (strain FSC 198)
B1JQC7 2.21e-06 47 33 4 99 3 rppH RNA pyrophosphohydrolase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q667F6 2.21e-06 47 33 4 99 3 rppH RNA pyrophosphohydrolase Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TLC8 2.21e-06 47 33 4 99 3 rppH RNA pyrophosphohydrolase Yersinia pestis (strain Pestoides F)
Q1CFB2 2.21e-06 47 33 4 99 3 rppH RNA pyrophosphohydrolase Yersinia pestis bv. Antiqua (strain Nepal516)
A9R2R6 2.21e-06 47 33 4 99 3 rppH RNA pyrophosphohydrolase Yersinia pestis bv. Antiqua (strain Angola)
Q8ZHU8 2.21e-06 47 33 4 99 3 rppH RNA pyrophosphohydrolase Yersinia pestis
B2JZ69 2.21e-06 47 33 4 99 3 rppH RNA pyrophosphohydrolase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1CAS2 2.21e-06 47 33 4 99 3 rppH RNA pyrophosphohydrolase Yersinia pestis bv. Antiqua (strain Antiqua)
A7FFD7 2.21e-06 47 33 4 99 3 rppH RNA pyrophosphohydrolase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A1JPE1 2.28e-06 47 33 4 99 3 rppH RNA pyrophosphohydrolase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
P9WIX9 2.78e-06 47 48 0 45 1 mutT3 Putative 8-oxo-dGTP diphosphatase 3 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WIX8 2.78e-06 47 48 0 45 3 mutT3 Putative 8-oxo-dGTP diphosphatase 3 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5UI45 2.79e-06 47 36 2 75 3 rppH RNA pyrophosphohydrolase Haemophilus influenzae (strain PittGG)
Q57045 3.02e-06 47 36 2 75 3 rppH RNA pyrophosphohydrolase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UDH3 3.09e-06 47 36 2 75 3 rppH RNA pyrophosphohydrolase Haemophilus influenzae (strain PittEE)
Q4QM07 3.12e-06 47 36 2 75 3 rppH RNA pyrophosphohydrolase Haemophilus influenzae (strain 86-028NP)
Q493D9 3.23e-06 47 31 2 80 3 rppH RNA pyrophosphohydrolase Blochmanniella pennsylvanica (strain BPEN)
Q0ABK6 3.75e-06 47 36 2 75 3 rppH RNA pyrophosphohydrolase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
A4WE06 3.99e-06 47 36 2 75 3 rppH RNA pyrophosphohydrolase Enterobacter sp. (strain 638)
Q6D8I9 4.11e-06 47 37 2 75 3 rppH RNA pyrophosphohydrolase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A6Q7F6 4.52e-06 46 36 4 83 3 rppH RNA pyrophosphohydrolase Sulfurovum sp. (strain NBC37-1)
B0TX27 4.59e-06 46 33 2 78 3 rppH RNA pyrophosphohydrolase Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
Q3SH26 4.6e-06 47 38 4 70 3 rppH RNA pyrophosphohydrolase Thiobacillus denitrificans (strain ATCC 25259)
Q65VJ5 4.99e-06 47 33 2 75 3 rppH RNA pyrophosphohydrolase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
B0UWT4 5.04e-06 47 36 2 75 3 rppH RNA pyrophosphohydrolase Histophilus somni (strain 2336)
Q0I560 5.04e-06 47 36 2 75 3 rppH RNA pyrophosphohydrolase Histophilus somni (strain 129Pt)
Q2YBW4 5.44e-06 47 32 3 87 3 rppH RNA pyrophosphohydrolase Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q0AGN1 5.61e-06 46 35 2 71 3 rppH RNA pyrophosphohydrolase Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
B3PIV4 5.91e-06 46 36 3 77 3 rppH RNA pyrophosphohydrolase Cellvibrio japonicus (strain Ueda107)
P57809 6.22e-06 46 34 2 75 3 rppH RNA pyrophosphohydrolase Pasteurella multocida (strain Pm70)
Q5P7T2 6.24e-06 46 31 5 105 3 rppH RNA pyrophosphohydrolase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q31GX8 7.14e-06 46 34 2 78 3 rppH RNA pyrophosphohydrolase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q1GZE7 8.46e-06 46 34 3 75 3 rppH RNA pyrophosphohydrolase Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q6G0S2 9.08e-06 46 31 3 87 3 rppH RNA pyrophosphohydrolase Bartonella quintana (strain Toulouse)
Q21NW8 1.02e-05 45 35 3 77 3 rppH RNA pyrophosphohydrolase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
C5BGJ4 1.04e-05 45 31 4 99 3 rppH RNA pyrophosphohydrolase Edwardsiella ictaluri (strain 93-146)
A6VMA3 1.07e-05 46 34 2 75 3 rppH RNA pyrophosphohydrolase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
C4K4A2 1.21e-05 45 33 6 106 3 rppH RNA pyrophosphohydrolase Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
O06972 1.26e-05 45 32 1 65 3 yvcI Uncharacterized Nudix hydrolase YvcI Bacillus subtilis (strain 168)
A2SD39 1.29e-05 45 34 3 75 3 rppH RNA pyrophosphohydrolase Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
Q7VTZ7 1.37e-05 45 32 4 87 3 rppH RNA pyrophosphohydrolase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7WFP0 1.37e-05 45 32 4 87 3 rppH RNA pyrophosphohydrolase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q3Z2Y5 1.37e-05 45 28 3 112 3 nudJ Phosphatase NudJ Shigella sonnei (strain Ss046)
Q31ZL0 1.37e-05 45 28 3 112 3 nudJ Phosphatase NudJ Shigella boydii serotype 4 (strain Sb227)
P0AEI9 1.4e-05 45 28 3 112 3 nudJ Phosphatase NudJ Shigella flexneri
Q0T5N8 1.4e-05 45 28 3 112 3 nudJ Phosphatase NudJ Shigella flexneri serotype 5b (strain 8401)
Q32EZ2 1.4e-05 45 28 3 112 3 nudJ Phosphatase NudJ Shigella dysenteriae serotype 1 (strain Sd197)
Q1RD19 1.4e-05 45 28 3 112 3 nudJ Phosphatase NudJ Escherichia coli (strain UTI89 / UPEC)
B1LI09 1.4e-05 45 28 3 112 3 nudJ Phosphatase NudJ Escherichia coli (strain SMS-3-5 / SECEC)
P0AEI6 1.4e-05 45 28 3 112 1 nudJ Phosphatase NudJ Escherichia coli (strain K12)
B1IUD3 1.4e-05 45 28 3 112 3 nudJ Phosphatase NudJ Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0AEI7 1.4e-05 45 28 3 112 3 nudJ Phosphatase NudJ Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TIT9 1.4e-05 45 28 3 112 3 nudJ Phosphatase NudJ Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AA28 1.4e-05 45 28 3 112 1 nudJ Phosphatase NudJ Escherichia coli O1:K1 / APEC
A7ZZ89 1.4e-05 45 28 3 112 3 nudJ Phosphatase NudJ Escherichia coli O9:H4 (strain HS)
B1XA44 1.4e-05 45 28 3 112 3 nudJ Phosphatase NudJ Escherichia coli (strain K12 / DH10B)
P0AEI8 1.4e-05 45 28 3 112 3 nudJ Phosphatase NudJ Escherichia coli O157:H7
A7ZKS4 1.4e-05 45 28 3 112 3 nudJ Phosphatase NudJ Escherichia coli O139:H28 (strain E24377A / ETEC)
Q7W482 1.46e-05 45 32 4 87 3 rppH RNA pyrophosphohydrolase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
B1XT37 1.62e-05 45 44 2 52 3 rppH RNA pyrophosphohydrolase Polynucleobacter necessarius subsp. necessarius (strain STIR1)
O31584 1.79e-05 45 31 1 82 2 mutY Adenine DNA glycosylase Bacillus subtilis (strain 168)
Q6AY63 1.82e-05 45 48 1 49 2 Nudt5 ADP-sugar pyrophosphatase Rattus norvegicus
A4SVA6 1.9e-05 45 44 2 52 3 rppH RNA pyrophosphohydrolase Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
Q9C6Z2 2e-05 45 34 2 66 1 NUDT25 Nudix hydrolase 25 Arabidopsis thaliana
Q82UZ9 2.04e-05 45 33 2 71 3 rppH RNA pyrophosphohydrolase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q1LSU2 2.09e-05 45 37 1 64 3 rppH RNA pyrophosphohydrolase Baumannia cicadellinicola subsp. Homalodisca coagulata
Q7NZ10 2.13e-05 45 33 4 87 3 rppH RNA pyrophosphohydrolase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q2S9N9 2.52e-05 44 43 1 51 3 rppH RNA pyrophosphohydrolase Hahella chejuensis (strain KCTC 2396)
A7MR28 2.58e-05 44 37 3 75 3 rppH RNA pyrophosphohydrolase Cronobacter sakazakii (strain ATCC BAA-894)
B0VEE3 2.65e-05 44 39 3 64 3 rppH RNA pyrophosphohydrolase Acinetobacter baumannii (strain AYE)
A3M1S5 2.65e-05 44 39 3 64 3 rppH RNA pyrophosphohydrolase Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B0VLB6 2.65e-05 44 39 3 64 3 rppH RNA pyrophosphohydrolase Acinetobacter baumannii (strain SDF)
B2I354 2.65e-05 44 39 3 64 3 rppH RNA pyrophosphohydrolase Acinetobacter baumannii (strain ACICU)
B7I4D7 2.65e-05 44 39 3 64 3 rppH RNA pyrophosphohydrolase Acinetobacter baumannii (strain AB0057)
B7H0U1 2.65e-05 44 39 3 64 3 rppH RNA pyrophosphohydrolase Acinetobacter baumannii (strain AB307-0294)
B3CM46 3.12e-05 44 33 6 111 3 rppH RNA pyrophosphohydrolase Wolbachia pipientis subsp. Culex pipiens (strain wPip)
Q2NRH0 3.16e-05 44 28 4 116 3 rppH RNA pyrophosphohydrolase Sodalis glossinidius (strain morsitans)
B8F8N4 3.19e-05 44 34 2 75 3 rppH RNA pyrophosphohydrolase Glaesserella parasuis serovar 5 (strain SH0165)
Q15P42 3.39e-05 44 37 3 78 3 rppH RNA pyrophosphohydrolase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q9X6X4 3.48e-05 45 40 1 59 3 lipB Octanoyltransferase Myxococcus xanthus
Q16BL5 3.56e-05 44 35 2 73 3 rppH RNA pyrophosphohydrolase Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
A1TYU2 3.82e-05 44 32 2 75 3 rppH RNA pyrophosphohydrolase Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
P0A779 4.27e-05 44 36 3 75 3 rppH RNA pyrophosphohydrolase Shigella flexneri
Q0T134 4.27e-05 44 36 3 75 3 rppH RNA pyrophosphohydrolase Shigella flexneri serotype 5b (strain 8401)
Q32C91 4.27e-05 44 36 3 75 3 rppH RNA pyrophosphohydrolase Shigella dysenteriae serotype 1 (strain Sd197)
Q1R7I3 4.27e-05 44 36 3 75 3 rppH RNA pyrophosphohydrolase Escherichia coli (strain UTI89 / UPEC)
B1LR27 4.27e-05 44 36 3 75 3 rppH RNA pyrophosphohydrolase Escherichia coli (strain SMS-3-5 / SECEC)
B6I6V5 4.27e-05 44 36 3 75 3 rppH RNA pyrophosphohydrolase Escherichia coli (strain SE11)
B7N762 4.27e-05 44 36 3 75 3 rppH RNA pyrophosphohydrolase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A776 4.27e-05 44 36 3 75 1 rppH RNA pyrophosphohydrolase Escherichia coli (strain K12)
B1IU14 4.27e-05 44 36 3 75 3 rppH RNA pyrophosphohydrolase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A777 4.27e-05 44 36 3 75 3 rppH RNA pyrophosphohydrolase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TE02 4.27e-05 44 36 3 75 3 rppH RNA pyrophosphohydrolase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A8A3W3 4.27e-05 44 36 3 75 3 rppH RNA pyrophosphohydrolase Escherichia coli O9:H4 (strain HS)
B1XDN6 4.27e-05 44 36 3 75 3 rppH RNA pyrophosphohydrolase Escherichia coli (strain K12 / DH10B)
C4ZZY2 4.27e-05 44 36 3 75 3 rppH RNA pyrophosphohydrolase Escherichia coli (strain K12 / MC4100 / BW2952)
B7LY86 4.27e-05 44 36 3 75 3 rppH RNA pyrophosphohydrolase Escherichia coli O8 (strain IAI1)
B7MYY4 4.27e-05 44 36 3 75 3 rppH RNA pyrophosphohydrolase Escherichia coli O81 (strain ED1a)
B7NVX5 4.27e-05 44 36 3 75 3 rppH RNA pyrophosphohydrolase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5Z4E7 4.27e-05 44 36 3 75 3 rppH RNA pyrophosphohydrolase Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A778 4.27e-05 44 36 3 75 3 rppH RNA pyrophosphohydrolase Escherichia coli O157:H7
B7LF07 4.27e-05 44 36 3 75 3 rppH RNA pyrophosphohydrolase Escherichia coli (strain 55989 / EAEC)
B7MLH6 4.27e-05 44 36 3 75 3 rppH RNA pyrophosphohydrolase Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UHP7 4.27e-05 44 36 3 75 3 rppH RNA pyrophosphohydrolase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZQT6 4.27e-05 44 36 3 75 3 rppH RNA pyrophosphohydrolase Escherichia coli O139:H28 (strain E24377A / ETEC)
Q3YY30 4.32e-05 44 36 3 75 3 rppH RNA pyrophosphohydrolase Shigella sonnei (strain Ss046)
B2TYR1 4.32e-05 44 36 3 75 3 rppH RNA pyrophosphohydrolase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
A9MS78 4.32e-05 44 36 3 75 3 rppH RNA pyrophosphohydrolase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
P65554 4.4e-05 44 36 3 75 3 rppH RNA pyrophosphohydrolase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P65555 4.4e-05 44 36 3 75 3 rppH RNA pyrophosphohydrolase Salmonella typhi
B4TUM2 4.4e-05 44 36 3 75 3 rppH RNA pyrophosphohydrolase Salmonella schwarzengrund (strain CVM19633)
B5BFH0 4.4e-05 44 36 3 75 3 rppH RNA pyrophosphohydrolase Salmonella paratyphi A (strain AKU_12601)
C0PXJ2 4.4e-05 44 36 3 75 3 rppH RNA pyrophosphohydrolase Salmonella paratyphi C (strain RKS4594)
A9N2M1 4.4e-05 44 36 3 75 3 rppH RNA pyrophosphohydrolase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PEN3 4.4e-05 44 36 3 75 3 rppH RNA pyrophosphohydrolase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T4Z7 4.4e-05 44 36 3 75 3 rppH RNA pyrophosphohydrolase Salmonella newport (strain SL254)
B4TGQ9 4.4e-05 44 36 3 75 3 rppH RNA pyrophosphohydrolase Salmonella heidelberg (strain SL476)
B5RDY0 4.4e-05 44 36 3 75 3 rppH RNA pyrophosphohydrolase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QWT6 4.4e-05 44 36 3 75 3 rppH RNA pyrophosphohydrolase Salmonella enteritidis PT4 (strain P125109)
B5FUB2 4.4e-05 44 36 3 75 3 rppH RNA pyrophosphohydrolase Salmonella dublin (strain CT_02021853)
Q57KB3 4.4e-05 44 36 3 75 3 rppH RNA pyrophosphohydrolase Salmonella choleraesuis (strain SC-B67)
B5F4U8 4.4e-05 44 36 3 75 3 rppH RNA pyrophosphohydrolase Salmonella agona (strain SL483)
B7LNI5 4.54e-05 44 34 2 75 3 rppH RNA pyrophosphohydrolase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
A1KV92 4.55e-05 44 31 4 87 3 rppH RNA pyrophosphohydrolase Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q31XF7 4.92e-05 43 36 3 75 3 rppH RNA pyrophosphohydrolase Shigella boydii serotype 4 (strain Sb227)
A6TDG6 4.92e-05 43 34 2 75 3 rppH RNA pyrophosphohydrolase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XUP9 4.97e-05 43 34 2 75 3 rppH RNA pyrophosphohydrolase Klebsiella pneumoniae (strain 342)
Q1GSV9 5.85e-05 43 34 3 86 3 rppH RNA pyrophosphohydrolase Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
C6DAE6 5.89e-05 43 36 2 75 3 rppH RNA pyrophosphohydrolase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q9JY96 6.47e-05 43 31 4 87 3 rppH RNA pyrophosphohydrolase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
A8GII0 7.37e-05 43 33 2 75 3 rppH RNA pyrophosphohydrolase Serratia proteamaculans (strain 568)
Q9ZJZ8 7.53e-05 43 27 4 112 3 rppH RNA pyrophosphohydrolase Helicobacter pylori (strain J99 / ATCC 700824)
Q5F753 7.92e-05 43 31 4 87 3 rppH RNA pyrophosphohydrolase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
A9M1Q5 8e-05 43 31 4 87 3 rppH RNA pyrophosphohydrolase Neisseria meningitidis serogroup C (strain 053442)
A9H3A6 8.2e-05 43 34 1 63 3 rppH RNA pyrophosphohydrolase Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
Q9JT78 9.69e-05 43 31 4 87 3 rppH RNA pyrophosphohydrolase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q5RCY2 9.89e-05 43 44 1 49 2 NUDT5 ADP-sugar pyrophosphatase Pongo abelii
P35640 9.92e-05 43 34 2 78 1 rppH RNA pyrophosphohydrolase Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
A6W1S0 0.000101 43 32 2 75 3 rppH RNA pyrophosphohydrolase Marinomonas sp. (strain MWYL1)
Q17VH2 0.000102 43 28 4 112 3 rppH RNA pyrophosphohydrolase Helicobacter acinonychis (strain Sheeba)
Q9UKK9 0.000119 43 44 1 49 1 NUDT5 ADP-sugar pyrophosphatase Homo sapiens
Q47IC9 0.000125 43 35 3 64 3 rppH RNA pyrophosphohydrolase Dechloromonas aromatica (strain RCB)
Q9JKX6 0.000126 43 48 1 49 1 Nudt5 ADP-sugar pyrophosphatase Mus musculus
O45830 0.000131 43 40 2 64 3 ndx-1 Putative nudix hydrolase 1 Caenorhabditis elegans
B2UUZ0 0.000132 42 28 4 112 3 rppH RNA pyrophosphohydrolase Helicobacter pylori (strain Shi470)
Q6FEW7 0.000135 42 42 2 52 3 rppH RNA pyrophosphohydrolase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q568Q0 0.000154 43 36 1 75 2 nudt18 8-oxo-dGDP phosphatase NUDT18 Danio rerio
B2VFV0 0.000155 42 34 3 75 3 rppH RNA pyrophosphohydrolase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A8FSC0 0.000157 42 34 3 75 3 rppH RNA pyrophosphohydrolase Shewanella sediminis (strain HAW-EB3)
A5FWY8 0.000162 42 32 2 71 3 rppH RNA pyrophosphohydrolase Acidiphilium cryptum (strain JF-5)
C0R4X8 0.000162 42 31 5 108 3 rppH RNA pyrophosphohydrolase Wolbachia sp. subsp. Drosophila simulans (strain wRi)
Q12KG5 0.000166 42 34 3 75 3 rppH RNA pyrophosphohydrolase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
B6JN68 0.00017 42 27 4 112 3 rppH RNA pyrophosphohydrolase Helicobacter pylori (strain P12)
Q1CS35 0.000173 42 27 4 112 3 rppH RNA pyrophosphohydrolase Helicobacter pylori (strain HPAG1)
B5Z8M3 0.000178 42 27 4 112 3 rppH RNA pyrophosphohydrolase Helicobacter pylori (strain G27)
B3CSR8 0.000194 42 31 5 103 3 rppH RNA pyrophosphohydrolase Orientia tsutsugamushi (strain Ikeda)
A5CD16 0.000194 42 31 5 103 3 rppH RNA pyrophosphohydrolase Orientia tsutsugamushi (strain Boryong)
P61787 0.000198 42 31 5 108 3 rppH RNA pyrophosphohydrolase Wolbachia pipientis wMel
Q5GT39 0.000202 42 37 2 61 3 rppH RNA pyrophosphohydrolase Wolbachia sp. subsp. Brugia malayi (strain TRS)
O25826 0.00021 42 27 4 112 3 rppH RNA pyrophosphohydrolase Helicobacter pylori (strain ATCC 700392 / 26695)
Q58549 0.000211 42 32 3 89 1 nudF ADP-ribose pyrophosphatase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q4FP40 0.000212 42 33 4 84 3 rppH RNA pyrophosphohydrolase Pelagibacter ubique (strain HTCC1062)
B5EKW6 0.000221 42 38 1 54 3 rppH RNA pyrophosphohydrolase Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
Q9KK72 0.000233 42 34 5 86 3 rppH RNA pyrophosphohydrolase Bartonella clarridgeiae
C1DCW2 0.000234 42 32 3 75 3 rppH RNA pyrophosphohydrolase Laribacter hongkongensis (strain HLHK9)
Q75UV1 0.000237 41 46 2 56 1 ndx1 Diadenosine hexaphosphate hydrolase Thermus thermophilus
A3QBR1 0.000239 42 37 3 75 3 rppH RNA pyrophosphohydrolase Shewanella loihica (strain ATCC BAA-1088 / PV-4)
C5BMA0 0.000255 42 33 3 77 3 rppH RNA pyrophosphohydrolase Teredinibacter turnerae (strain ATCC 39867 / T7901)
Q2RV14 0.000262 42 46 2 47 3 rppH RNA pyrophosphohydrolase Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
B1KI42 0.000265 42 33 3 75 3 rppH RNA pyrophosphohydrolase Shewanella woodyi (strain ATCC 51908 / MS32)
Q47Y27 0.000266 42 32 2 75 3 rppH RNA pyrophosphohydrolase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q6LLW5 0.000268 42 28 3 111 3 nudC NAD-capped RNA hydrolase NudC Photobacterium profundum (strain SS9)
Q8EH98 0.000275 42 34 3 75 3 rppH RNA pyrophosphohydrolase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
B8CQL0 0.000317 42 34 3 75 3 rppH RNA pyrophosphohydrolase Shewanella piezotolerans (strain WP3 / JCM 13877)
Q9RH11 0.000338 41 31 3 91 3 rppH RNA pyrophosphohydrolase Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
A3N3J1 0.00036 42 33 2 75 3 rppH RNA pyrophosphohydrolase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q606D2 0.000365 42 30 4 88 3 rppH RNA pyrophosphohydrolase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
B1J2P0 0.00037 41 30 2 78 3 rppH RNA pyrophosphohydrolase Pseudomonas putida (strain W619)
Q88CN4 0.00037 41 30 2 78 3 rppH RNA pyrophosphohydrolase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KP24 0.00037 41 30 2 78 3 rppH RNA pyrophosphohydrolase Pseudomonas putida (strain GB-1)
Q1I3C2 0.00037 41 30 2 78 3 rppH RNA pyrophosphohydrolase Pseudomonas entomophila (strain L48)
A5WAL1 0.000382 41 30 2 78 3 rppH RNA pyrophosphohydrolase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q07YY0 0.000385 41 34 3 75 3 rppH RNA pyrophosphohydrolase Shewanella frigidimarina (strain NCIMB 400)
B3H2W6 0.000401 41 33 2 75 3 rppH RNA pyrophosphohydrolase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
B0BTH6 0.000409 41 33 2 75 3 rppH RNA pyrophosphohydrolase Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
A0KZP9 0.000428 41 33 3 75 3 rppH RNA pyrophosphohydrolase Shewanella sp. (strain ANA-3)
Q9RV46 0.000467 41 37 3 67 1 DR_1184 Nudix hydrolase DR_1184 Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q7VPB7 0.00049 41 33 2 75 3 rppH RNA pyrophosphohydrolase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q3U2V3 0.000498 42 31 1 74 1 Nudt18 8-oxo-dGDP phosphatase NUDT18 Mus musculus
Q641Y7 0.000508 42 31 1 74 2 Nudt18 8-oxo-dGDP phosphatase NUDT18 Rattus norvegicus
A8H1B1 0.000513 41 34 3 75 3 rppH RNA pyrophosphohydrolase Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B0TIU1 0.000513 41 34 3 75 3 rppH RNA pyrophosphohydrolase Shewanella halifaxensis (strain HAW-EB4)
P46351 0.000569 41 37 1 53 4 None Uncharacterized 45.4 kDa protein in thiaminase I 5'region Paenibacillus thiaminolyticus
Q9F7A2 0.000578 40 39 1 51 3 gmm GDP-mannose mannosyl hydrolase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z5H2 0.000578 40 39 1 51 3 gmm GDP-mannose mannosyl hydrolase Salmonella typhi
Q9X4P2 0.000589 40 30 2 78 3 rppH RNA pyrophosphohydrolase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02U79 0.000589 40 30 2 78 3 rppH RNA pyrophosphohydrolase Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V2P9 0.000589 40 30 2 78 3 rppH RNA pyrophosphohydrolase Pseudomonas aeruginosa (strain LESB58)
A6UYD9 0.000589 40 30 2 78 3 rppH RNA pyrophosphohydrolase Pseudomonas aeruginosa (strain PA7)
Q98F04 0.000602 41 34 3 82 3 rppH RNA pyrophosphohydrolase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
A5WHX7 0.000615 40 32 2 81 3 rppH RNA pyrophosphohydrolase Psychrobacter sp. (strain PRwf-1)
A4Y049 0.000632 40 30 2 78 3 rppH RNA pyrophosphohydrolase Pseudomonas mendocina (strain ymp)
C1DK22 0.000658 40 32 2 75 3 rppH RNA pyrophosphohydrolase Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q2G7H8 0.000684 40 32 3 81 3 rppH RNA pyrophosphohydrolase Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
A1RME4 0.000819 40 33 3 75 3 rppH RNA pyrophosphohydrolase Shewanella sp. (strain W3-18-1)
A4Y4I7 0.000819 40 33 3 75 3 rppH RNA pyrophosphohydrolase Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
P32091 0.000848 40 39 1 58 3 None MutT-like protein Streptomyces ambofaciens
Q0HSH4 0.001 40 32 3 75 3 rppH RNA pyrophosphohydrolase Shewanella sp. (strain MR-7)
Q0HG81 0.001 40 32 3 75 3 rppH RNA pyrophosphohydrolase Shewanella sp. (strain MR-4)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_06250
Feature type CDS
Gene mutT
Product 8-oxo-dGTP diphosphatase MutT
Location 44309 - 44701 (strand: -1)
Length 393 (nucleotides) / 130 (amino acids)
In genomic island -

Contig

Accession ZDB_683
Length 224720 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_916
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF14815 NUDIX domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1051 Nucleotide transport and metabolism (F) F ADP-ribose pyrophosphatase YjhB, NUDIX family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03574 8-oxo-dGTP diphosphatase [EC:3.6.1.55] - -

Protein Sequence

MEKKHLRIAAGVIRNAEGEIFIAQRPLKSHMGGYWEFPGGKLESGESPEQALVRELEEELGIVAVPGELLQTAEHEFPDRLITIYFFLVEEWQNAPYGREGQPSRWVKQTALIAEEFPPVNRGIVALLTE

Flanking regions ( +/- flanking 50bp)

AAAGGCGGGGGAACCCGCCTTTCTTCTGTAAATAAAACGGACAGAACATGATGGAAAAAAAACACTTACGTATTGCCGCCGGCGTTATCCGTAATGCAGAAGGTGAGATATTTATTGCTCAGCGTCCGCTGAAATCTCATATGGGCGGTTACTGGGAGTTTCCCGGCGGTAAGCTGGAATCCGGAGAGTCACCGGAGCAGGCGCTGGTGCGGGAGCTGGAAGAGGAGCTGGGTATTGTGGCGGTTCCGGGAGAACTGCTGCAGACGGCAGAACATGAATTTCCGGATCGCCTGATCACCATTTATTTCTTTCTGGTGGAAGAGTGGCAGAATGCGCCATATGGTCGCGAAGGTCAGCCATCCCGCTGGGTAAAACAAACAGCACTGATTGCTGAGGAGTTCCCGCCGGTTAACCGGGGAATTGTGGCATTGCTGACAGAATAAGATTCAGAGGTACGGCGGCGGCTGTTTTAATTCAGCCGCTGCCGGATTAA