Homologs in group_1877

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_14040 FBDBKF_14040 100.0 Morganella morganii S1 - GhoT/OrtT family toxin
EHELCC_08240 EHELCC_08240 100.0 Morganella morganii S2 - GhoT/OrtT family toxin
NLDBIP_08565 NLDBIP_08565 100.0 Morganella morganii S4 - GhoT/OrtT family toxin
LHKJJB_05700 LHKJJB_05700 100.0 Morganella morganii S3 - GhoT/OrtT family toxin
F4V73_RS02900 F4V73_RS02900 89.7 Morganella psychrotolerans - GhoT/OrtT family toxin
PMI_RS08365 PMI_RS08365 56.9 Proteus mirabilis HI4320 - GhoT/OrtT family toxin

Distribution of the homologs in the orthogroup group_1877

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1877

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P64453 7e-10 51 46 1 58 1 ortT Orphan toxin OrtT Escherichia coli (strain K12)
P64454 7e-10 51 46 1 58 3 ortT Orphan toxin OrtT Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P64646 2.39e-08 47 46 1 52 1 ghoT Toxin GhoT Escherichia coli (strain K12)
P64647 2.39e-08 47 46 1 52 3 ghoT Toxin GhoT Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P64648 2.39e-08 47 46 1 52 3 ghoT Toxin GhoT Escherichia coli O157:H7

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_05215
Feature type CDS
Gene -
Product GhoT/OrtT family toxin
Location 100756 - 100932 (strand: -1)
Length 177 (nucleotides) / 58 (amino acids)

Contig

Accession ZDB_682
Length 259781 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1877
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF10753 Toxin GhoT_OrtT

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K18839 toxin GhoT - -

Protein Sequence

MSSAQILLTIYATGGLLSFILTFFLTKDPNPFFRLLSCLLIALTWPMSLPVVILFSLF

Flanking regions ( +/- flanking 50bp)

CACGCGGGGTGAGGTACACTACCCTCATCAGTTTAACTAATGTAACCGTTATGTCCTCTGCACAGATTTTACTGACTATCTACGCAACAGGTGGTCTTCTTTCATTCATTCTGACTTTTTTCCTGACAAAAGATCCGAACCCGTTTTTCCGCCTGCTCAGTTGCCTGCTGATAGCCCTCACCTGGCCGATGTCATTACCGGTGGTTATTTTATTTTCTCTGTTCTGACTGGTTTTAAACCCACAATATTCCCGCTGTCATCACCAGACAAAAAAGCA