Homologs in group_3434

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_14460 FBDBKF_14460 100.0 Morganella morganii S1 - Thymidylate synthase
EHELCC_07820 EHELCC_07820 100.0 Morganella morganii S2 - Thymidylate synthase
NLDBIP_08145 NLDBIP_08145 100.0 Morganella morganii S4 - Thymidylate synthase
LHKJJB_06120 LHKJJB_06120 100.0 Morganella morganii S3 - Thymidylate synthase

Distribution of the homologs in the orthogroup group_3434

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3434

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
C9DGK1 2.61e-45 160 34 8 293 1 230 Deoxyuridylate hydroxymethyltransferase Delftia phage PhiW-14
P0DTK3 9.71e-17 83 27 5 219 1 None Deoxyuridylate hydroxymethyltransferase Pseudomonas phage M6
P31654 3.91e-13 72 28 5 202 1 None Deoxyuridylate hydroxymethyltransferase Bacillus phage SP01
Q6A761 6.14e-10 62 24 8 208 3 thyA Thymidylate synthase Cutibacterium acnes (strain DSM 16379 / KPA171202)
Q044A1 8.07e-10 62 27 5 149 3 thyA Thymidylate synthase Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
A7GP90 9.71e-10 62 26 6 166 3 thyA Thymidylate synthase Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q04B29 1.29e-09 62 30 8 150 3 thyA Thymidylate synthase Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q1GAP2 1.29e-09 62 30 8 150 3 thyA Thymidylate synthase Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
Q03F96 1.69e-09 61 26 7 169 3 thyA Thymidylate synthase Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
P47469 2.16e-09 61 29 6 148 3 thyA Thymidylate synthase Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q6F145 3.8e-09 60 25 6 180 3 thyA Thymidylate synthase Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1)
Q63BV5 6.42e-09 60 25 6 166 3 thyA Thymidylate synthase Bacillus cereus (strain ZK / E33L)
Q738X7 6.54e-09 59 25 6 166 3 thyA Thymidylate synthase Bacillus cereus (strain ATCC 10987 / NRS 248)
Q81E05 6.78e-09 59 25 6 166 3 thyA Thymidylate synthase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
A8YUW0 6.85e-09 59 26 7 160 3 thyA Thymidylate synthase Lactobacillus helveticus (strain DPC 4571)
Q6HJC7 7.1e-09 59 25 6 166 3 thyA Thymidylate synthase Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q81R23 7.1e-09 59 25 6 166 3 thyA Thymidylate synthase Bacillus anthracis
A0RDL9 7.1e-09 59 25 6 166 3 thyA Thymidylate synthase Bacillus thuringiensis (strain Al Hakam)
Q0VM06 9.85e-09 58 23 8 217 3 thyA Thymidylate synthase Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q5FKL6 1.36e-08 58 25 7 167 3 thyA Thymidylate synthase Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q74IU3 2.28e-08 58 27 6 159 3 thyA Thymidylate synthase Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q5WSU5 4.92e-08 56 28 9 204 3 thyA Thymidylate synthase Legionella pneumophila (strain Lens)
Q31I55 6.52e-08 56 25 7 177 3 thyA Thymidylate synthase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q5X119 7.41e-08 56 28 9 204 3 thyA Thymidylate synthase Legionella pneumophila (strain Paris)
A5II41 7.69e-08 56 28 9 204 3 thyA Thymidylate synthase Legionella pneumophila (strain Corby)
Q6QGJ5 9.64e-08 56 26 9 202 1 thy Probable thymidylate synthase Escherichia phage T5
Q88W05 1.81e-07 55 24 6 172 3 thyA Thymidylate synthase Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q5GWB5 1.87e-07 55 24 8 210 3 thyA Thymidylate synthase Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2NZH9 1.87e-07 55 24 8 210 3 thyA Thymidylate synthase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
A5WHY0 1.94e-07 55 28 5 146 3 thyA Thymidylate synthase Psychrobacter sp. (strain PRwf-1)
Q5ZRL3 2e-07 55 28 9 204 3 thyA Thymidylate synthase Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q21NW5 3.18e-07 54 25 5 164 3 thyA Thymidylate synthase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q0AHA4 3.32e-07 54 25 8 210 3 thyA Thymidylate synthase Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
A0AJY0 3.56e-07 54 26 7 157 3 thyA Thymidylate synthase Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
P59427 4.03e-07 53 24 7 197 3 thyA Thymidylate synthase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q8EV81 5.16e-07 53 26 6 159 3 thyA Thymidylate synthase Malacoplasma penetrans (strain HF-2)
Q0ABR1 6.05e-07 53 23 8 212 3 thyA Thymidylate synthase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q1Q8B2 6.64e-07 53 28 7 151 3 thyA Thymidylate synthase Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q8Y626 6.79e-07 53 25 8 174 3 thyA Thymidylate synthase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
B8DDM8 8.15e-07 53 25 7 157 3 thyA Thymidylate synthase Listeria monocytogenes serotype 4a (strain HCC23)
A4YZC4 8.43e-07 53 25 8 201 3 thyA Thymidylate synthase Bradyrhizobium sp. (strain ORS 278)
Q92AD4 8.84e-07 53 25 7 157 3 thyA Thymidylate synthase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q4A611 9.1e-07 53 23 6 182 3 thyA Thymidylate synthase Mycoplasmopsis synoviae (strain 53)
Q71YE1 9.17e-07 53 25 7 157 3 thyA Thymidylate synthase Listeria monocytogenes serotype 4b (strain F2365)
Q5WDS1 9.86e-07 52 24 6 169 3 thyA Thymidylate synthase Shouchella clausii (strain KSM-K16)
A9IW82 1.17e-06 52 26 7 169 3 thyA Thymidylate synthase Bartonella tribocorum (strain CIP 105476 / IBS 506)
Q6G2S8 1.21e-06 52 23 6 169 3 thyA Thymidylate synthase Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
C3PEY5 1.22e-06 52 26 4 120 3 thyA Thymidylate synthase Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CIP 107346 / CN-1)
A7Z5T3 1.37e-06 52 25 6 148 3 thyA Thymidylate synthase Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
C1KWH4 1.81e-06 52 25 7 157 3 thyA Thymidylate synthase Listeria monocytogenes serotype 4b (strain CLIP80459)
A0LY29 1.89e-06 52 24 8 201 3 thyA Thymidylate synthase Christiangramia forsetii (strain DSM 17595 / CGMCC 1.15422 / KT0803)
A6WGF9 2e-06 52 26 4 125 3 thyA Thymidylate synthase Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216)
Q9XC19 2.02e-06 52 24 5 155 3 thyA Thymidylate synthase Mycoplasmoides gallisepticum (strain R(low / passage 15 / clone 2))
A6UB24 3.17e-06 51 25 5 131 3 thyA Thymidylate synthase Sinorhizobium medicae (strain WSM419)
A0PQG7 3.27e-06 51 23 5 134 3 thyA Thymidylate synthase Mycobacterium ulcerans (strain Agy99)
Q6MID2 3.74e-06 51 23 9 214 3 thyA Thymidylate synthase Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
Q87BT4 3.99e-06 51 24 6 169 3 thyA Thymidylate synthase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q2SA17 4.21e-06 50 23 6 167 3 thyA Thymidylate synthase Hahella chejuensis (strain KCTC 2396)
Q834R3 5.91e-06 50 23 7 185 1 thyA Thymidylate synthase Enterococcus faecalis (strain ATCC 700802 / V583)
B7I4U0 6.91e-06 50 22 4 158 1 thyA Thymidylate synthase Acinetobacter baumannii (strain AB0057)
B7H0P4 6.91e-06 50 22 4 158 3 thyA Thymidylate synthase Acinetobacter baumannii (strain AB307-0294)
Q1WU17 9.39e-06 50 23 6 153 3 thyA Thymidylate synthase Ligilactobacillus salivarius (strain UCC118)
Q8G3T9 9.56e-06 50 24 8 214 3 thyA Thymidylate synthase Bifidobacterium longum (strain NCC 2705)
Q6AFI0 1.07e-05 49 23 6 175 3 thyA Thymidylate synthase Leifsonia xyli subsp. xyli (strain CTCB07)
Q38WX8 1.08e-05 50 23 4 139 3 thyA Thymidylate synthase Latilactobacillus sakei subsp. sakei (strain 23K)
Q9PB13 1.18e-05 49 23 6 169 3 thyA Thymidylate synthase Xylella fastidiosa (strain 9a5c)
Q8K9C3 1.25e-05 49 24 9 195 3 thyA Thymidylate synthase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
A8FEB9 1.47e-05 49 21 6 206 3 thyA Thymidylate synthase Bacillus pumilus (strain SAFR-032)
B8GN06 1.53e-05 49 22 7 184 3 thyA Thymidylate synthase Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
C5DAR2 1.58e-05 49 26 9 207 3 thyA Thymidylate synthase Geobacillus sp. (strain WCH70)
Q92NQ5 1.81e-05 48 25 5 131 3 thyA Thymidylate synthase Rhizobium meliloti (strain 1021)
A9NG27 2.76e-05 48 23 7 169 3 thyA Thymidylate synthase Acholeplasma laidlawii (strain PG-8A)
A5EVG5 4.13e-05 48 26 4 108 3 thyA Thymidylate synthase Dichelobacter nodosus (strain VCS1703A)
Q9RAM7 4.39e-05 47 24 5 133 3 thyA1 Thymidylate synthase Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q03YZ8 4.87e-05 48 27 5 133 3 thyA Thymidylate synthase Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
Q98Q31 5.07e-05 47 25 7 163 3 thyA Thymidylate synthase Mycoplasmopsis pulmonis (strain UAB CTIP)
Q9Z671 5.53e-05 47 23 5 168 3 thyA Thymidylate synthase Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q8DUI4 6.22e-05 47 28 6 145 3 thyA Thymidylate synthase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q7MTB5 6.27e-05 47 21 8 216 3 thyA Thymidylate synthase Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
P0DG67 8.4e-05 47 28 6 145 3 thyA Thymidylate synthase Streptococcus pyogenes serotype M3 (strain SSI-1)
P0DG66 8.4e-05 47 28 6 145 3 thyA Thymidylate synthase Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P67051 8.4e-05 47 28 6 145 3 thyA Thymidylate synthase Streptococcus pyogenes serotype M1
Q48U25 8.71e-05 47 28 6 145 3 thyA Thymidylate synthase Streptococcus pyogenes serotype M28 (strain MGAS6180)
A2RF20 8.71e-05 47 28 6 145 3 thyA Thymidylate synthase Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J744 8.71e-05 47 28 6 145 3 thyA Thymidylate synthase Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JHC5 8.71e-05 47 28 6 145 3 thyA Thymidylate synthase Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q8P1D1 8.71e-05 47 28 6 145 3 thyA Thymidylate synthase Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5XCM3 8.71e-05 47 28 6 145 3 thyA Thymidylate synthase Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
O26868 0.000124 46 27 6 143 3 thyA Putative thymidylate synthase Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q3SH96 0.000157 46 24 3 111 3 thyA Thymidylate synthase Thiobacillus denitrificans (strain ATCC 25259)
Q1JM80 0.000232 45 28 6 145 3 thyA Thymidylate synthase Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JC96 0.000232 45 28 6 145 3 thyA Thymidylate synthase Streptococcus pyogenes serotype M12 (strain MGAS2096)
A3CMU9 0.000243 45 27 7 155 3 thyA Thymidylate synthase Streptococcus sanguinis (strain SK36)
Q4JX59 0.000243 45 25 4 120 3 thyA Thymidylate synthase Corynebacterium jeikeium (strain K411)
P00471 0.000264 45 25 5 151 1 TD Thymidylate synthase Enterobacteria phage T4
P08773 0.00028 45 25 1 101 1 42 Deoxycytidylate 5-hydroxymethyltransferase Enterobacteria phage T4
Q07422 0.000407 45 26 7 149 1 None Bifunctional dihydrofolate reductase-thymidylate synthase Toxoplasma gondii
A8AXC2 0.000457 45 27 7 155 3 thyA Thymidylate synthase Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
P18030 0.00049 44 25 1 108 3 42 Deoxycytidylate 5-hydroxymethyltransferase Enterobacteria phage T6
P18029 0.001 43 29 1 82 3 42 Deoxycytidylate 5-hydroxymethyltransferase Enterobacteria phage T2

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_04795
Feature type CDS
Gene -
Product Thymidylate synthase
Location 10293 - 11276 (strand: -1)
Length 984 (nucleotides) / 327 (amino acids)

Contig

Accession ZDB_682
Length 259781 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3434
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Domains

PF00303 Thymidylate synthase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0207 Nucleotide transport and metabolism (F) F Thymidylate synthase

Kegg Ortholog Annotation(s)

Protein Sequence

MTIYDISVILRNPRSRHLSLAGRKNNIFATFAEAIWVFAGDNRINPYLTFFLPRAPKYSDDGVIWRAAYGERLYAHGQLENVVQQFKKEGIFTRRAVISLYMPDRDTNESLIKVYNLEHSADIPCNNLIHFFITPDKKLNIKIAQRSGDLIFGLSYINIFEFSLLQEIVLSILQRDVDSNIKLGYLHLSVTNLHIYEDKIEQAEEIYKRKEEQVTNLKNNDAILFPPSLQNIKSLFCDIVSFLEGIITKNTHEIDTINKETEKLKKIFIKHFVKTERNLLWGYAEAALSYIFQKRFNQPIVLTAKLSNDFNLSVTSNHFNNSNKERL

Flanking regions ( +/- flanking 50bp)

AAAAAGTGCTTAATGAAGGGGTTCGCATATCAACAAGGAATGGGGATGCTATGACTATTTATGATATTAGTGTGATCTTACGTAACCCTAGATCAAGGCATTTAAGTTTAGCCGGTCGAAAAAATAATATATTCGCCACATTTGCTGAAGCTATATGGGTGTTTGCTGGCGATAACCGAATTAACCCTTATCTAACTTTTTTTTTACCAAGAGCGCCAAAATACTCAGATGATGGTGTCATTTGGCGAGCAGCTTATGGAGAAAGACTATACGCTCACGGGCAACTTGAAAATGTCGTTCAACAATTCAAAAAAGAAGGAATATTTACAAGAAGAGCAGTCATTAGTTTATACATGCCTGACAGAGATACGAATGAAAGTCTCATAAAAGTATATAACTTGGAACATAGTGCTGATATACCATGCAATAATCTAATTCATTTCTTTATCACTCCAGATAAAAAATTAAACATTAAAATAGCCCAAAGAAGTGGAGACCTAATATTTGGACTAAGCTATATAAATATTTTCGAGTTTAGTTTACTTCAGGAGATAGTACTTTCCATATTACAGAGGGACGTTGATAGCAATATCAAACTTGGATATTTACATCTATCAGTAACAAACCTTCATATATATGAGGATAAAATAGAGCAAGCCGAAGAAATATACAAAAGAAAAGAAGAGCAAGTAACGAATTTGAAAAATAATGATGCAATATTATTTCCCCCATCGCTACAAAATATAAAATCATTATTTTGCGATATAGTTTCATTTCTTGAAGGAATAATAACAAAAAATACACATGAAATAGACACAATAAATAAGGAAACAGAAAAATTAAAAAAAATATTTATTAAACACTTTGTGAAAACTGAAAGGAATTTACTTTGGGGATATGCAGAAGCAGCTTTATCATATATTTTTCAGAAACGGTTTAACCAACCAATAGTGTTAACAGCTAAGTTAAGCAATGATTTCAATCTAAGCGTAACTTCAAATCACTTTAATAATTCTAATAAGGAGCGTTTATGAAAATTGCATTCATGGGAATATCGGGTAGTGGAAAAGATTTCCTTGCTAAT