Homologs in group_3441

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_14520 FBDBKF_14520 100.0 Morganella morganii S1 - Mutator family transposase
EHELCC_07760 EHELCC_07760 100.0 Morganella morganii S2 - Mutator family transposase
NLDBIP_08085 NLDBIP_08085 100.0 Morganella morganii S4 - Mutator family transposase
LHKJJB_06180 LHKJJB_06180 100.0 Morganella morganii S3 - Mutator family transposase

Distribution of the homologs in the orthogroup group_3441

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3441

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_04735
Feature type CDS
Gene -
Product Mutator family transposase
Location 2198 - 2455 (strand: 1)
Length 258 (nucleotides) / 85 (amino acids)
In genomic island GI76

Contig

Accession ZDB_682
Length 259781 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3441
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Protein Sequence

MTQLFDFDNALKALQNGQALIGKDGILTPLIKQLTESALAAELDSYSPMMLKLTVGMALRKRPLKHQPVFELATPRDRNGSFNHN

Flanking regions ( +/- flanking 50bp)

GTTAGAAATTCTGTGTCATTCCAGTAATATCTACCAAAAAGGAATGACAAATGACTCAACTTTTTGATTTCGACAACGCCCTGAAAGCCCTTCAGAATGGTCAGGCTCTGATCGGTAAAGATGGCATCCTGACCCCGCTGATTAAGCAACTTACTGAATCTGCATTGGCCGCAGAACTTGACTCCTACTCACCAATGATGCTGAAGCTAACCGTAGGAATGGCTCTACGAAAAAGACCATTAAAGCACCAACCGGTATTTGAGCTGGCTACTCCACGCGATCGCAACGGCTCTTTTAACCACAACTGATGAAGAAGCACCAGACCACACTATCAAACGAGATTGAGCAAAAAATTATC