Homologs in group_2618

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_03770 FBDBKF_03770 100.0 Morganella morganii S1 ubiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benz oquinol methylase
EHELCC_06765 EHELCC_06765 100.0 Morganella morganii S2 ubiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benz oquinol methylase
NLDBIP_07090 NLDBIP_07090 100.0 Morganella morganii S4 ubiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benz oquinol methylase
LHKJJB_06625 LHKJJB_06625 100.0 Morganella morganii S3 ubiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benz oquinol methylase
PMI_RS00125 PMI_RS00125 59.8 Proteus mirabilis HI4320 - class I SAM-dependent methyltransferase

Distribution of the homologs in the orthogroup group_2618

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2618

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P70976 2.11e-82 250 46 3 260 3 ybaJ Uncharacterized methyltransferase YbaJ Bacillus subtilis (strain 168)
Q2L2T5 3.09e-09 59 30 1 121 3 ubiG Ubiquinone biosynthesis O-methyltransferase Bordetella avium (strain 197N)
Q87ND5 1.57e-08 57 30 2 151 3 ubiG Ubiquinone biosynthesis O-methyltransferase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q5GZB5 1.99e-08 57 36 3 113 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SHS9 1.99e-08 57 36 3 113 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2P2C4 1.99e-08 57 36 3 113 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q7VZG7 2.39e-07 53 30 1 121 3 ubiG Ubiquinone biosynthesis O-methyltransferase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
A7MU79 2.97e-07 53 31 3 153 3 ubiG Ubiquinone biosynthesis O-methyltransferase Vibrio campbellii (strain ATCC BAA-1116)
Q4W9V1 3.95e-07 53 30 3 107 1 erg6 Sterol 24-C-methyltransferase erg6 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q02PX7 6.42e-07 52 28 1 120 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas aeruginosa (strain UCBPP-PA14)
Q9P3R1 6.88e-07 53 33 3 104 3 erg-4 Sterol 24-C-methyltransferase erg-4 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
B7V9J5 1.02e-06 52 28 1 120 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas aeruginosa (strain LESB58)
Q9HZ63 1.05e-06 52 28 1 120 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q885T9 1.2e-06 51 28 1 120 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q7WGT9 1.32e-06 51 29 1 121 3 ubiG Ubiquinone biosynthesis O-methyltransferase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q9KJ21 1.92e-06 51 31 4 125 1 None Sarcosine/dimethylglycine N-methyltransferase Halorhodospira halochloris
L0E172 2.38e-06 51 34 3 100 3 phqN Methyltransferase phqN Penicillium fellutanum
Q3BSF8 2.45e-06 50 29 0 108 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q8P8H2 2.79e-06 50 34 3 112 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RS27 2.79e-06 50 34 3 112 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xanthomonas campestris pv. campestris (strain B100)
Q4UVL4 2.79e-06 50 34 3 112 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xanthomonas campestris pv. campestris (strain 8004)
Q47GP8 3.52e-06 50 27 3 162 3 ubiG Ubiquinone biosynthesis O-methyltransferase Dechloromonas aromatica (strain RCB)
Q7VKW2 3.91e-06 50 32 1 112 3 ubiG Ubiquinone biosynthesis O-methyltransferase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
A6V2Q4 4.17e-06 50 28 1 120 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas aeruginosa (strain PA7)
Q8PK00 4.59e-06 50 30 0 105 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xanthomonas axonopodis pv. citri (strain 306)
C1DRQ3 4.75e-06 50 28 1 120 3 ubiG Ubiquinone biosynthesis O-methyltransferase Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
P64842 5.11e-06 50 27 5 200 3 BQ2027_MB1440C Uncharacterized protein Mb1440c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WLY7 5.11e-06 50 27 5 200 1 Rv1405c Uncharacterized protein Rv1405c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WLY6 5.11e-06 50 27 5 200 3 MT1449 Uncharacterized protein MT1449 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q7W5Z6 5.72e-06 49 29 1 121 3 ubiG Ubiquinone biosynthesis O-methyltransferase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q5P7U3 6.64e-06 49 30 1 120 3 ubiG Ubiquinone biosynthesis O-methyltransferase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
P0CT10 7.11e-06 50 30 3 107 3 ERG6 Sterol 24-C-methyltransferase Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)
L7IP31 7.11e-06 50 30 3 107 2 ERG6 Sterol 24-C-methyltransferase Pyricularia oryzae (strain Y34)
Q6D7X5 7.3e-06 49 29 2 127 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
B3H0C8 8.16e-06 49 25 5 180 3 ubiG Ubiquinone biosynthesis O-methyltransferase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A0A0E0SMA3 1.05e-05 49 30 3 107 2 ERG6B Sterol 24-C-methyltransferase ERG6B Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
A7MPA9 1.18e-05 48 29 0 109 3 ubiG Ubiquinone biosynthesis O-methyltransferase Cronobacter sakazakii (strain ATCC BAA-894)
B7NN47 1.22e-05 48 29 0 109 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Q7NZ91 1.27e-05 48 30 1 120 3 ubiG Ubiquinone biosynthesis O-methyltransferase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
B7LM95 1.31e-05 48 29 0 109 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
A3MZ07 1.45e-05 48 25 5 180 3 ubiG Ubiquinone biosynthesis O-methyltransferase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
P59911 1.63e-05 48 28 3 134 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Haemophilus ducreyi (strain 35000HP / ATCC 700724)
I1RGC4 1.81e-05 48 28 3 107 2 FG02783.1 Sterol 24-C-methyltransferase ERG6A Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
C6DBN5 1.94e-05 48 28 2 127 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q8FFP0 1.99e-05 48 29 0 109 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B5YX17 2.07e-05 48 29 0 109 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XE29 2.07e-05 48 29 0 109 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli O157:H7
Q31Z65 2.11e-05 48 29 0 109 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shigella boydii serotype 4 (strain Sb227)
B2TW20 2.11e-05 48 29 0 109 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B6I7I7 2.11e-05 48 29 0 109 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli (strain SE11)
B7M5R7 2.11e-05 48 29 0 109 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli O8 (strain IAI1)
B7LAP9 2.11e-05 48 29 0 109 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli (strain 55989 / EAEC)
B1IXV6 2.14e-05 48 29 0 109 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q3YZX6 2.19e-05 48 29 0 109 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shigella sonnei (strain Ss046)
Q820C5 2.19e-05 48 29 0 109 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shigella flexneri
Q0T2P9 2.19e-05 48 29 0 109 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shigella flexneri serotype 5b (strain 8401)
Q32DV8 2.19e-05 48 29 0 109 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shigella dysenteriae serotype 1 (strain Sd197)
B7N5J4 2.19e-05 48 29 0 109 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P17993 2.19e-05 48 29 0 109 1 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli (strain K12)
B1X8C6 2.19e-05 48 29 0 109 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli (strain K12 / DH10B)
C4ZU73 2.19e-05 48 29 0 109 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli (strain K12 / MC4100 / BW2952)
A7ZP50 2.19e-05 48 29 0 109 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli O139:H28 (strain E24377A / ETEC)
B7UFP4 2.23e-05 48 29 0 109 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7MQL7 2.27e-05 48 28 3 134 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Cronobacter sakazakii (strain ATCC BAA-894)
Q1R9I4 2.29e-05 48 29 0 109 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli (strain UTI89 / UPEC)
B7MFZ8 2.29e-05 48 29 0 109 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli O45:K1 (strain S88 / ExPEC)
Q0TFL0 2.35e-05 48 29 0 109 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7MXR3 2.35e-05 48 29 0 109 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli O81 (strain ED1a)
A8A296 2.38e-05 47 29 0 109 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli O9:H4 (strain HS)
B2VIL6 2.4e-05 48 27 1 121 3 ubiG Ubiquinone biosynthesis O-methyltransferase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q7MM27 2.55e-05 47 31 0 105 3 ubiG Ubiquinone biosynthesis O-methyltransferase Vibrio vulnificus (strain YJ016)
Q8D8E0 2.55e-05 47 31 0 105 3 ubiG Ubiquinone biosynthesis O-methyltransferase Vibrio vulnificus (strain CMCP6)
B1LLI3 2.58e-05 47 29 0 109 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli (strain SMS-3-5 / SECEC)
Q3SK91 2.67e-05 47 30 1 120 3 ubiG Ubiquinone biosynthesis O-methyltransferase Thiobacillus denitrificans (strain ATCC 25259)
Q609G2 2.73e-05 47 31 0 107 3 ubiG Ubiquinone biosynthesis O-methyltransferase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q9KJ20 2.9e-05 48 34 3 101 1 None Glycine/sarcosine/dimethylglycine N-methyltransferase Actinopolyspora halophila
Q96WX4 3.17e-05 48 27 3 98 1 erg6 Sterol 24-C-methyltransferase Pneumocystis carinii (strain B80)
Q2NSL7 3.22e-05 47 28 1 121 3 ubiG Ubiquinone biosynthesis O-methyltransferase Sodalis glossinidius (strain morsitans)
C3LLV3 4.12e-05 47 30 0 108 3 ubiG Ubiquinone biosynthesis O-methyltransferase Vibrio cholerae serotype O1 (strain M66-2)
Q9KSJ9 4.12e-05 47 30 0 108 3 ubiG Ubiquinone biosynthesis O-methyltransferase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F1U0 4.12e-05 47 30 0 108 3 ubiG Ubiquinone biosynthesis O-methyltransferase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
A6TBT7 4.17e-05 47 29 0 109 3 ubiG Ubiquinone biosynthesis O-methyltransferase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q9PAM5 4.23e-05 47 30 5 148 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xylella fastidiosa (strain 9a5c)
Q4ZQ90 4.5e-05 47 25 1 120 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas syringae pv. syringae (strain B728a)
Q48FM4 4.5e-05 47 25 1 120 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
B4EZ30 4.97e-05 47 26 0 105 3 ubiG Ubiquinone biosynthesis O-methyltransferase Proteus mirabilis (strain HI4320)
B7VGS0 5.55e-05 47 29 0 105 3 ubiG Ubiquinone biosynthesis O-methyltransferase Vibrio atlanticus (strain LGP32)
H2E7T9 5.72e-05 47 34 2 97 2 SMT-2 Sterol methyltransferase-like 2 Botryococcus braunii
B5FDT8 6.75e-05 46 30 0 105 3 ubiG Ubiquinone biosynthesis O-methyltransferase Aliivibrio fischeri (strain MJ11)
A8G8B8 7.1e-05 46 27 4 166 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Serratia proteamaculans (strain 568)
C5BCA4 7.72e-05 46 26 4 171 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Edwardsiella ictaluri (strain 93-146)
Q0AA73 7.77e-05 46 31 3 125 3 ubiG Ubiquinone biosynthesis O-methyltransferase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
A6TGL3 7.79e-05 46 28 3 130 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q5E5J8 7.83e-05 46 30 0 105 3 ubiG Ubiquinone biosynthesis O-methyltransferase Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q9CKD6 7.9e-05 46 29 3 130 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pasteurella multocida (strain Pm70)
B0U3W1 8.4e-05 46 27 2 143 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xylella fastidiosa (strain M12)
B5XYI1 8.54e-05 46 28 3 130 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Klebsiella pneumoniae (strain 342)
P54458 8.84e-05 46 37 4 102 3 yqeM Putative methyltransferase YqeM Bacillus subtilis (strain 168)
B2I023 9.7e-05 46 25 3 135 3 ubiG Ubiquinone biosynthesis O-methyltransferase Acinetobacter baumannii (strain ACICU)
B0V5X4 9.97e-05 46 25 3 135 3 ubiG Ubiquinone biosynthesis O-methyltransferase Acinetobacter baumannii (strain AYE)
B7IBN2 9.97e-05 46 25 3 135 3 ubiG Ubiquinone biosynthesis O-methyltransferase Acinetobacter baumannii (strain AB0057)
B7H2Y9 9.97e-05 46 25 3 135 3 ubiG Ubiquinone biosynthesis O-methyltransferase Acinetobacter baumannii (strain AB307-0294)
B0VMN8 0.000106 45 25 3 135 3 ubiG Ubiquinone biosynthesis O-methyltransferase Acinetobacter baumannii (strain SDF)
B0KTX4 0.000115 45 28 4 128 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas putida (strain GB-1)
B5XNZ3 0.000116 45 28 0 109 3 ubiG Ubiquinone biosynthesis O-methyltransferase Klebsiella pneumoniae (strain 342)
Q88M10 0.000118 45 28 4 128 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5W7G3 0.000118 45 28 4 128 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
A9MJY3 0.000145 45 28 0 109 3 ubiG Ubiquinone biosynthesis O-methyltransferase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A8ADY5 0.000166 45 28 0 109 3 ubiG Ubiquinone biosynthesis O-methyltransferase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q87BG5 0.000185 45 29 5 148 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I705 0.000185 45 29 5 148 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xylella fastidiosa (strain M23)
Q3J8U2 0.000203 45 30 0 108 3 ubiG Ubiquinone biosynthesis O-methyltransferase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q8Y0Z5 0.000205 45 28 3 144 3 ubiG Ubiquinone biosynthesis O-methyltransferase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q6FFY1 0.000211 45 25 3 135 3 ubiG Ubiquinone biosynthesis O-methyltransferase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q1IDA6 0.000236 45 26 1 120 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas entomophila (strain L48)
A9WRT1 0.000239 45 31 2 116 3 menG Demethylmenaquinone methyltransferase Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235)
A9L2Y4 0.000246 45 27 0 109 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shewanella baltica (strain OS195)
A6WNN7 0.000246 45 27 0 109 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shewanella baltica (strain OS185)
A3D499 0.000246 45 27 0 109 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8EA88 0.000246 45 27 0 109 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shewanella baltica (strain OS223)
A8ACY2 0.000247 45 27 3 130 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q7N2M5 0.000249 45 27 0 109 3 ubiG Ubiquinone biosynthesis O-methyltransferase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q4K8M4 0.000282 44 26 3 144 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
B1J5G4 0.000284 44 25 1 120 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas putida (strain W619)
C3MCY6 0.00029 44 32 4 110 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Sinorhizobium fredii (strain NBRC 101917 / NGR234)
H2E7T5 0.000393 44 33 4 103 1 TMT-1 Squalene methyltransferase 1 Botryococcus braunii
Q3K8T6 0.000397 44 26 1 120 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas fluorescens (strain Pf0-1)
A1TSA0 0.000399 44 28 6 162 3 ubiG Ubiquinone biosynthesis O-methyltransferase Paracidovorax citrulli (strain AAC00-1)
P37431 0.000456 44 27 0 109 3 ubiG Ubiquinone biosynthesis O-methyltransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TPG0 0.000456 44 27 0 109 3 ubiG Ubiquinone biosynthesis O-methyltransferase Salmonella schwarzengrund (strain CVM19633)
B4SYU8 0.000456 44 27 0 109 3 ubiG Ubiquinone biosynthesis O-methyltransferase Salmonella newport (strain SL254)
B4TBE3 0.000456 44 27 0 109 3 ubiG Ubiquinone biosynthesis O-methyltransferase Salmonella heidelberg (strain SL476)
B5FNR7 0.000456 44 27 0 109 3 ubiG Ubiquinone biosynthesis O-methyltransferase Salmonella dublin (strain CT_02021853)
B5EYW1 0.000456 44 27 0 109 3 ubiG Ubiquinone biosynthesis O-methyltransferase Salmonella agona (strain SL483)
Q8Z560 0.000486 43 27 0 109 3 ubiG Ubiquinone biosynthesis O-methyltransferase Salmonella typhi
A6UFF7 0.000519 43 31 4 110 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Sinorhizobium medicae (strain WSM419)
A4WFY5 0.000594 43 27 3 130 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Enterobacter sp. (strain 638)
Q6CYB3 0.000601 44 29 2 91 3 ERG6 Sterol 24-C-methyltransferase Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)
Q6DAQ7 0.000707 43 26 3 133 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q54VN2 0.000763 43 28 2 106 3 coq5 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial Dictyostelium discoideum
Q5QZ53 0.000826 43 27 0 108 3 ubiG Ubiquinone biosynthesis O-methyltransferase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q21UL3 0.000846 43 30 3 125 3 ubiG Ubiquinone biosynthesis O-methyltransferase Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q81ZZ2 0.000854 43 30 4 126 3 ubiG Ubiquinone biosynthesis O-methyltransferase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
C6DI77 0.000873 43 26 3 130 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pectobacterium carotovorum subsp. carotovorum (strain PC1)
B2JEZ6 0.001 43 26 1 123 3 ubiG Ubiquinone biosynthesis O-methyltransferase Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
C3K6J1 0.001 43 25 3 144 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas fluorescens (strain SBW25)
Q55423 0.001 43 33 3 109 3 sll0829 Uncharacterized methyltransferase sll0829 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
A4Y759 0.001 43 25 2 131 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A1RJD1 0.001 43 25 2 131 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shewanella sp. (strain W3-18-1)
A4WCN5 0.001 43 28 0 109 3 ubiG Ubiquinone biosynthesis O-methyltransferase Enterobacter sp. (strain 638)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_04305
Feature type CDS
Gene ubiG
Product 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benz oquinol methylase
Location 180743 - 181525 (strand: 1)
Length 783 (nucleotides) / 260 (amino acids)

Contig

Accession ZDB_681
Length 269562 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2618
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF08241 Methyltransferase domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2226 Coenzyme transport and metabolism (H) H Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG

Protein Sequence

MTDFLTSNQAAWDKQAEQQQAWSTPVSAELIAAAKQGNWDVHLTPQPLPKDWLGDVKGKRILCLASAGGQQAPVLAAAGADVTVFDLSDKQLEHDRQVARRDGLTLKAVQGDMRDLSAFADGTFDCVFHPISNLYIPDVNPVWRECHRVLKTGGTLLASFFNSVVFVGDRDAKYREEGIIKPAYKMPFSELTALTPEQVAEKQARQEAFVFGHSLTDLIGGQLKAGFHLTDFYEDWQPNPRFVIDNYLPTFIATAAVKIG

Flanking regions ( +/- flanking 50bp)

ACTTCAGACAGGTTAAATTGCGTACATTATGTATTATGGAGTACAAAATTATGACGGATTTTTTAACCTCAAACCAGGCCGCGTGGGATAAACAGGCGGAACAACAACAGGCGTGGTCAACACCGGTCAGCGCAGAGCTGATTGCGGCTGCCAAACAAGGAAACTGGGATGTGCATCTCACCCCGCAGCCGCTGCCGAAAGACTGGCTGGGGGATGTGAAAGGCAAACGCATTCTCTGTCTGGCCTCTGCCGGTGGTCAGCAGGCCCCGGTACTGGCTGCCGCCGGTGCGGATGTGACAGTGTTTGATTTATCAGATAAACAGCTTGAGCACGATCGTCAGGTTGCCCGGCGCGACGGGCTGACACTTAAGGCGGTACAGGGCGATATGCGGGATCTCAGCGCATTTGCGGATGGCACTTTTGACTGCGTGTTCCATCCGATTTCCAATCTGTATATCCCGGATGTGAATCCGGTATGGCGTGAATGCCACCGCGTACTGAAAACCGGCGGCACACTATTGGCCAGTTTCTTTAATTCAGTGGTCTTTGTCGGCGATCGTGATGCGAAATACCGCGAAGAAGGCATTATAAAACCAGCATATAAAATGCCGTTTTCTGAACTGACAGCATTAACACCGGAGCAGGTGGCAGAGAAGCAGGCACGGCAGGAAGCTTTTGTGTTTGGCCATTCCCTGACAGATTTGATCGGCGGACAACTGAAAGCCGGTTTTCATCTGACCGATTTTTATGAGGACTGGCAACCGAACCCGCGTTTTGTTATCGATAATTATCTGCCGACATTTATTGCGACTGCGGCAGTGAAGATTGGCTGATTTTTCATGCGTTTTTGTAAATACAGATACAACAAACCGTGATTACGGTG