Homologs in group_2625

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_03430 FBDBKF_03430 100.0 Morganella morganii S1 kdpC potassium-transporting ATPase subunit KdpC
EHELCC_07105 EHELCC_07105 100.0 Morganella morganii S2 kdpC potassium-transporting ATPase subunit KdpC
NLDBIP_07430 NLDBIP_07430 100.0 Morganella morganii S4 kdpC potassium-transporting ATPase subunit KdpC
LHKJJB_06965 LHKJJB_06965 100.0 Morganella morganii S3 kdpC potassium-transporting ATPase subunit KdpC
F4V73_RS11470 F4V73_RS11470 84.2 Morganella psychrotolerans kdpC potassium-transporting ATPase subunit KdpC

Distribution of the homologs in the orthogroup group_2625

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2625

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
A7MQV0 4.43e-75 226 58 0 187 3 kdpC Potassium-transporting ATPase KdpC subunit Cronobacter sakazakii (strain ATCC BAA-894)
B7UKX5 6.38e-74 224 60 0 186 3 kdpC Potassium-transporting ATPase KdpC subunit Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A4W859 7.23e-73 221 56 0 188 3 kdpC Potassium-transporting ATPase KdpC subunit Enterobacter sp. (strain 638)
B7NMP9 1.81e-70 215 60 0 186 3 kdpC Potassium-transporting ATPase KdpC subunit Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B4TQ21 2.65e-70 214 57 0 187 3 kdpC Potassium-transporting ATPase KdpC subunit Salmonella schwarzengrund (strain CVM19633)
B4TBA5 3.36e-70 214 57 0 187 3 kdpC Potassium-transporting ATPase KdpC subunit Salmonella heidelberg (strain SL476)
Q8Z8E6 3.48e-70 214 57 0 187 3 kdpC Potassium-transporting ATPase KdpC subunit Salmonella typhi
B7LKR8 6.28e-70 214 60 0 186 3 kdpC Potassium-transporting ATPase KdpC subunit Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B1LLE0 6.63e-70 213 60 0 186 3 kdpC Potassium-transporting ATPase KdpC subunit Escherichia coli (strain SMS-3-5 / SECEC)
B5R669 6.84e-70 214 57 0 187 3 kdpC Potassium-transporting ATPase KdpC subunit Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QWE8 6.84e-70 214 57 0 187 3 kdpC Potassium-transporting ATPase KdpC subunit Salmonella enteritidis PT4 (strain P125109)
B5FND9 6.84e-70 214 57 0 187 3 kdpC Potassium-transporting ATPase KdpC subunit Salmonella dublin (strain CT_02021853)
Q57RN1 8.15e-70 213 57 0 187 3 kdpC Potassium-transporting ATPase KdpC subunit Salmonella choleraesuis (strain SC-B67)
Q0T6U0 8.43e-70 213 59 0 186 3 kdpC Potassium-transporting ATPase KdpC subunit Shigella flexneri serotype 5b (strain 8401)
Q8ZQW3 8.52e-70 213 57 0 187 3 kdpC Potassium-transporting ATPase KdpC subunit Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A9MUE1 8.52e-70 213 57 0 187 3 kdpC Potassium-transporting ATPase KdpC subunit Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4SZB0 8.52e-70 213 57 0 187 3 kdpC Potassium-transporting ATPase KdpC subunit Salmonella newport (strain SL254)
B5EZE2 8.52e-70 213 57 0 187 3 kdpC Potassium-transporting ATPase KdpC subunit Salmonella agona (strain SL483)
A7ZXV7 8.81e-70 213 60 0 186 3 kdpC Potassium-transporting ATPase KdpC subunit Escherichia coli O9:H4 (strain HS)
Q3Z4A7 1.02e-69 213 59 0 186 3 kdpC Potassium-transporting ATPase KdpC subunit Shigella sonnei (strain Ss046)
B7MPJ9 1.05e-69 213 60 0 186 3 kdpC Potassium-transporting ATPase KdpC subunit Escherichia coli O81 (strain ED1a)
Q8FJV5 1.16e-69 213 60 0 186 3 kdpC Potassium-transporting ATPase KdpC subunit Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TJZ0 1.16e-69 213 60 0 186 3 kdpC Potassium-transporting ATPase KdpC subunit Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7MFW1 1.28e-69 213 60 0 186 3 kdpC Potassium-transporting ATPase KdpC subunit Escherichia coli O45:K1 (strain S88 / ExPEC)
P03961 2.28e-69 212 60 0 186 1 kdpC Potassium-transporting ATPase KdpC subunit Escherichia coli (strain K12)
B1IY33 2.28e-69 212 60 0 186 3 kdpC Potassium-transporting ATPase KdpC subunit Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
B1X6M7 2.28e-69 212 60 0 186 3 kdpC Potassium-transporting ATPase KdpC subunit Escherichia coli (strain K12 / DH10B)
C4ZWH2 2.28e-69 212 60 0 186 3 kdpC Potassium-transporting ATPase KdpC subunit Escherichia coli (strain K12 / MC4100 / BW2952)
A6T6D7 4.16e-69 211 58 0 187 3 kdpC Potassium-transporting ATPase KdpC subunit Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B7N9T9 8.93e-69 211 59 0 186 3 kdpC Potassium-transporting ATPase KdpC subunit Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B5XZF0 1.27e-68 210 58 0 187 3 kdpC Potassium-transporting ATPase KdpC subunit Klebsiella pneumoniae (strain 342)
B5YQN8 1.84e-68 210 59 0 186 3 kdpC Potassium-transporting ATPase KdpC subunit Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X9G0 1.84e-68 210 59 0 186 3 kdpC Potassium-transporting ATPase KdpC subunit Escherichia coli O157:H7
B7M5L2 2.55e-68 209 58 0 186 3 kdpC Potassium-transporting ATPase KdpC subunit Escherichia coli O8 (strain IAI1)
B7LAA3 2.55e-68 209 58 0 186 3 kdpC Potassium-transporting ATPase KdpC subunit Escherichia coli (strain 55989 / EAEC)
Q32IN4 3.04e-68 209 59 0 186 3 kdpC Potassium-transporting ATPase KdpC subunit Shigella dysenteriae serotype 1 (strain Sd197)
B6HYQ4 4.65e-68 209 59 0 186 3 kdpC Potassium-transporting ATPase KdpC subunit Escherichia coli (strain SE11)
A7ZJ79 1.09e-67 208 58 0 186 3 kdpC Potassium-transporting ATPase KdpC subunit Escherichia coli O139:H28 (strain E24377A / ETEC)
A1JQS4 1.37e-67 208 56 0 192 3 kdpC Potassium-transporting ATPase KdpC subunit Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q2NW73 1.76e-67 207 55 0 188 3 kdpC Potassium-transporting ATPase KdpC subunit Sodalis glossinidius (strain morsitans)
Q8ZD98 1.16e-64 201 53 0 196 3 kdpC Potassium-transporting ATPase KdpC subunit Yersinia pestis
A7FFQ7 1.16e-64 201 53 0 196 3 kdpC Potassium-transporting ATPase KdpC subunit Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A8GB60 5.01e-64 199 54 0 187 3 kdpC Potassium-transporting ATPase KdpC subunit Serratia proteamaculans (strain 568)
Q2SZS2 3.23e-62 194 56 0 186 3 kdpC Potassium-transporting ATPase KdpC subunit Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q7N6W7 7.82e-62 193 53 0 186 3 kdpC Potassium-transporting ATPase KdpC subunit Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q89FC4 4.34e-60 189 51 2 201 3 kdpC Potassium-transporting ATPase KdpC subunit Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
C5CPD2 6.15e-60 188 53 0 189 3 kdpC Potassium-transporting ATPase KdpC subunit Variovorax paradoxus (strain S110)
Q1BUX7 7.9e-60 188 56 0 189 3 kdpC Potassium-transporting ATPase KdpC subunit Burkholderia orbicola (strain AU 1054)
A0K960 7.9e-60 188 56 0 189 3 kdpC Potassium-transporting ATPase KdpC subunit Burkholderia cenocepacia (strain HI2424)
B1JVS7 1.75e-59 187 55 0 187 3 kdpC Potassium-transporting ATPase KdpC subunit Burkholderia orbicola (strain MC0-3)
A4JGG7 4.19e-59 186 55 0 184 3 kdpC Potassium-transporting ATPase KdpC subunit Burkholderia vietnamiensis (strain G4 / LMG 22486)
A9AJK8 2.22e-58 184 54 0 189 3 kdpC Potassium-transporting ATPase KdpC subunit Burkholderia multivorans (strain ATCC 17616 / 249)
Q8U9E0 2.69e-58 184 52 2 185 3 kdpC Potassium-transporting ATPase KdpC subunit Agrobacterium fabrum (strain C58 / ATCC 33970)
Q1QJ48 6.87e-58 184 51 2 201 3 kdpC Potassium-transporting ATPase KdpC subunit Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
B2VJK2 8.54e-58 183 59 0 178 3 kdpC Potassium-transporting ATPase KdpC subunit Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A4G5J7 1.06e-57 182 51 0 187 3 kdpC Potassium-transporting ATPase KdpC subunit Herminiimonas arsenicoxydans
B2T2B4 1.26e-57 182 51 0 183 3 kdpC Potassium-transporting ATPase KdpC subunit Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
B8ETA0 2.2e-57 182 49 2 197 3 kdpC Potassium-transporting ATPase KdpC subunit Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
Q98GX7 2.55e-57 181 52 2 179 3 kdpC Potassium-transporting ATPase KdpC subunit Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q63VS1 3.15e-57 181 56 0 189 3 kdpC Potassium-transporting ATPase KdpC subunit Burkholderia pseudomallei (strain K96243)
A3N7H1 3.15e-57 181 56 0 189 3 kdpC Potassium-transporting ATPase KdpC subunit Burkholderia pseudomallei (strain 668)
Q3JUE8 3.15e-57 181 56 0 189 3 kdpC Potassium-transporting ATPase KdpC subunit Burkholderia pseudomallei (strain 1710b)
A3NT59 3.15e-57 181 56 0 189 3 kdpC Potassium-transporting ATPase KdpC subunit Burkholderia pseudomallei (strain 1106a)
A1V2H2 3.15e-57 181 56 0 189 3 kdpC Potassium-transporting ATPase KdpC subunit Burkholderia mallei (strain SAVP1)
Q62IJ8 3.15e-57 181 56 0 189 3 kdpC Potassium-transporting ATPase KdpC subunit Burkholderia mallei (strain ATCC 23344)
A2S4A3 3.15e-57 181 56 0 189 3 kdpC Potassium-transporting ATPase KdpC subunit Burkholderia mallei (strain NCTC 10229)
A3MI57 3.15e-57 181 56 0 189 3 kdpC Potassium-transporting ATPase KdpC subunit Burkholderia mallei (strain NCTC 10247)
Q0BD93 5.25e-57 181 54 0 187 3 kdpC Potassium-transporting ATPase KdpC subunit Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
C1F0T4 5.8e-57 181 54 3 186 3 kdpC Potassium-transporting ATPase KdpC subunit Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / BCRC 80197 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161)
B4E5Q9 8.49e-57 180 53 0 189 3 kdpC Potassium-transporting ATPase KdpC subunit Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
B3Q8S9 9.98e-57 180 48 2 200 3 kdpC Potassium-transporting ATPase KdpC subunit Rhodopseudomonas palustris (strain TIE-1)
Q6N5H2 3.13e-56 179 48 2 200 3 kdpC Potassium-transporting ATPase KdpC subunit Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
B1M7D4 5.46e-56 179 50 2 197 3 kdpC Potassium-transporting ATPase KdpC subunit Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
Q8XU10 5.74e-56 179 51 0 182 3 kdpC Potassium-transporting ATPase KdpC subunit Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q605R3 6.13e-56 178 55 0 187 3 kdpC Potassium-transporting ATPase KdpC subunit Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
A7IKC3 6.64e-56 178 49 2 197 3 kdpC Potassium-transporting ATPase KdpC subunit Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
A6X5I0 3.18e-55 176 47 2 186 3 kdpC Potassium-transporting ATPase KdpC subunit Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q142K7 6.3e-55 176 50 0 183 3 kdpC Potassium-transporting ATPase KdpC subunit Paraburkholderia xenovorans (strain LB400)
B6JA60 7.59e-55 175 51 2 187 3 kdpC Potassium-transporting ATPase KdpC subunit Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
A9VZA4 9.68e-55 175 48 2 197 3 kdpC Potassium-transporting ATPase KdpC subunit Methylorubrum extorquens (strain PA1)
B6IQY7 2.28e-54 175 52 2 190 3 kdpC Potassium-transporting ATPase KdpC subunit Rhodospirillum centenum (strain ATCC 51521 / SW)
A9AXV2 3.08e-54 174 49 0 183 3 kdpC Potassium-transporting ATPase KdpC subunit Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785 / 114-95)
A6SZ14 5.84e-54 173 52 2 186 3 kdpC Potassium-transporting ATPase KdpC subunit Janthinobacterium sp. (strain Marseille)
Q07HN8 1.09e-53 172 47 2 201 3 kdpC Potassium-transporting ATPase KdpC subunit Rhodopseudomonas palustris (strain BisA53)
B9JKQ9 2.11e-53 172 48 2 195 3 kdpC Potassium-transporting ATPase KdpC subunit Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
C1ABQ7 2.39e-53 172 47 1 196 3 kdpC Potassium-transporting ATPase KdpC subunit Gemmatimonas aurantiaca (strain DSM 14586 / JCM 11422 / NBRC 100505 / T-27)
Q47H40 4.61e-53 171 49 0 184 3 kdpC Potassium-transporting ATPase KdpC subunit Dechloromonas aromatica (strain RCB)
Q02CX5 2.83e-52 169 49 0 186 3 kdpC Potassium-transporting ATPase KdpC subunit Solibacter usitatus (strain Ellin6076)
B8I9I8 7.49e-52 168 47 2 197 3 kdpC Potassium-transporting ATPase KdpC subunit Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
B1YTU3 2.58e-51 166 54 0 187 3 kdpC Potassium-transporting ATPase KdpC subunit Burkholderia ambifaria (strain MC40-6)
A4SZG7 3.98e-51 166 47 0 187 3 kdpC Potassium-transporting ATPase KdpC subunit Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
B2IIP7 1.17e-50 165 48 1 188 3 kdpC Potassium-transporting ATPase KdpC subunit Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
B7L1N2 1.9e-50 164 45 2 196 3 kdpC Potassium-transporting ATPase KdpC subunit Methylorubrum extorquens (strain CM4 / NCIMB 13688)
A1VTC0 3.81e-50 164 53 0 184 3 kdpC Potassium-transporting ATPase KdpC subunit Polaromonas naphthalenivorans (strain CJ2)
A2SIS1 6.02e-50 163 55 0 170 3 kdpC Potassium-transporting ATPase KdpC subunit Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
B8DR36 6.34e-50 163 50 0 175 3 kdpC Potassium-transporting ATPase KdpC subunit Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
Q13DD7 9.59e-50 162 47 2 198 3 kdpC Potassium-transporting ATPase KdpC subunit Rhodopseudomonas palustris (strain BisB5)
P9WKF1 1.66e-49 162 50 2 185 1 kdpC Potassium-transporting ATPase KdpC subunit Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WKF0 1.66e-49 162 50 2 185 3 kdpC Potassium-transporting ATPase KdpC subunit Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U175 1.66e-49 162 50 2 185 3 kdpC Potassium-transporting ATPase KdpC subunit Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1AM23 1.66e-49 162 50 2 185 3 kdpC Potassium-transporting ATPase KdpC subunit Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KHH0 1.66e-49 162 50 2 185 3 kdpC Potassium-transporting ATPase KdpC subunit Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P65212 1.66e-49 162 50 2 185 3 kdpC Potassium-transporting ATPase KdpC subunit Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q6D7I5 1.97e-49 161 50 1 175 3 kdpC Potassium-transporting ATPase KdpC subunit Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q20XR6 2.68e-49 161 49 2 189 3 kdpC Potassium-transporting ATPase KdpC subunit Rhodopseudomonas palustris (strain BisB18)
A5EQ10 6.78e-49 160 46 2 189 3 kdpC Potassium-transporting ATPase KdpC subunit Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
B8GVG0 7.81e-49 160 48 3 189 3 kdpC Potassium-transporting ATPase KdpC subunit Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A7X6 7.81e-49 160 48 3 189 3 kdpC Potassium-transporting ATPase KdpC subunit Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
A4Z016 1.76e-48 159 48 2 192 3 kdpC Potassium-transporting ATPase KdpC subunit Bradyrhizobium sp. (strain ORS 278)
B5EH78 2.28e-48 159 45 2 187 3 kdpC Potassium-transporting ATPase KdpC subunit Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
B1Z9X9 4.75e-48 158 46 2 197 3 kdpC Potassium-transporting ATPase KdpC subunit Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
B9K2I1 3.03e-47 156 45 1 192 3 kdpC Potassium-transporting ATPase KdpC subunit Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
B2JE25 3.55e-47 156 49 1 186 3 kdpC Potassium-transporting ATPase KdpC subunit Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q74AA8 1.15e-46 154 45 2 187 3 kdpC Potassium-transporting ATPase KdpC subunit Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
B3EAQ1 4.05e-46 153 46 3 188 3 kdpC Potassium-transporting ATPase KdpC subunit Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
Q39SW4 1.43e-45 152 45 2 187 3 kdpC Potassium-transporting ATPase KdpC subunit Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q1IUD3 4.04e-45 150 43 2 181 3 kdpC Potassium-transporting ATPase KdpC subunit Koribacter versatilis (strain Ellin345)
Q92XJ1 5.79e-45 150 45 1 187 3 kdpC Potassium-transporting ATPase KdpC subunit Rhizobium meliloti (strain 1021)
A5GAG0 1.93e-44 149 44 2 187 3 kdpC Potassium-transporting ATPase KdpC subunit Geotalea uraniireducens (strain Rf4)
Q9RZN6 3.15e-44 149 48 2 180 3 kdpC Potassium-transporting ATPase KdpC subunit Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
A9F781 1.21e-42 144 46 0 174 3 kdpC Potassium-transporting ATPase KdpC subunit Sorangium cellulosum (strain So ce56)
Q8R8I7 3.81e-42 143 41 2 184 3 kdpC Potassium-transporting ATPase KdpC subunit Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
B0SYJ5 9.68e-42 142 44 3 189 3 kdpC Potassium-transporting ATPase KdpC subunit Caulobacter sp. (strain K31)
B7UV86 2.34e-41 140 46 4 186 3 kdpC Potassium-transporting ATPase KdpC subunit Pseudomonas aeruginosa (strain LESB58)
A8HY21 4.4e-41 140 45 1 186 3 kdpC Potassium-transporting ATPase KdpC subunit Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
A7GLG5 7.79e-41 140 42 2 181 3 kdpC Potassium-transporting ATPase KdpC subunit Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q2RV87 4.64e-40 137 50 1 186 3 kdpC Potassium-transporting ATPase KdpC subunit Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q48K34 6.78e-40 137 43 5 185 3 kdpC Potassium-transporting ATPase KdpC subunit Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q0TRT2 2.89e-39 136 40 2 194 3 kdpC Potassium-transporting ATPase KdpC subunit Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q88FD8 3.12e-39 135 44 4 184 3 kdpC Potassium-transporting ATPase KdpC subunit Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5W155 3.12e-39 135 44 4 184 3 kdpC Potassium-transporting ATPase KdpC subunit Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q5HK65 3.55e-39 135 41 6 195 3 kdpC Potassium-transporting ATPase KdpC subunit Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P0A060 3.55e-39 135 41 6 195 3 kdpC Potassium-transporting ATPase KdpC subunit Staphylococcus aureus
P0A059 3.55e-39 135 41 6 195 1 kdpC2 Potassium-transporting ATPase KdpC subunit 2 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5LHU5 5.83e-39 135 42 4 192 3 kdpC Potassium-transporting ATPase KdpC subunit Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
Q64YU7 7.32e-39 134 42 4 192 3 kdpC Potassium-transporting ATPase KdpC subunit Bacteroides fragilis (strain YCH46)
Q81UW5 1.71e-38 134 41 3 186 3 kdpC Potassium-transporting ATPase KdpC subunit Bacillus anthracis
C3LF98 1.71e-38 134 41 3 186 3 kdpC Potassium-transporting ATPase KdpC subunit Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P0M1 1.71e-38 134 41 3 186 3 kdpC Potassium-transporting ATPase KdpC subunit Bacillus anthracis (strain A0248)
Q7NN39 1.72e-38 134 42 4 188 3 kdpC Potassium-transporting ATPase KdpC subunit Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q883V4 2.31e-38 133 43 4 186 3 kdpC Potassium-transporting ATPase KdpC subunit Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
B7JRB9 2.44e-38 133 41 3 186 3 kdpC Potassium-transporting ATPase KdpC subunit Bacillus cereus (strain AH820)
B9IQY6 2.52e-38 133 42 3 186 3 kdpC Potassium-transporting ATPase KdpC subunit Bacillus cereus (strain Q1)
Q6HN77 3.68e-38 133 41 3 184 3 kdpC Potassium-transporting ATPase KdpC subunit Bacillus thuringiensis subsp. konkukian (strain 97-27)
C1EYK1 7.17e-38 132 41 3 186 3 kdpC Potassium-transporting ATPase KdpC subunit Bacillus cereus (strain 03BB102)
B7HWG2 7.35e-38 132 41 3 186 3 kdpC Potassium-transporting ATPase KdpC subunit Bacillus cereus (strain AH187)
B9KPZ0 7.94e-38 132 45 2 190 3 kdpC Potassium-transporting ATPase KdpC subunit Cereibacter sphaeroides (strain KD131 / KCTC 12085)
Q73DA2 8.47e-38 132 41 3 186 3 kdpC Potassium-transporting ATPase KdpC subunit Bacillus cereus (strain ATCC 10987 / NRS 248)
Q2YUH8 1.16e-37 131 40 4 192 3 kdpC Potassium-transporting ATPase KdpC subunit Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q6GEZ8 1.25e-37 131 41 5 192 3 kdpC Potassium-transporting ATPase KdpC subunit Staphylococcus aureus (strain MRSA252)
Q63FQ9 1.82e-37 131 41 3 186 3 kdpC Potassium-transporting ATPase KdpC subunit Bacillus cereus (strain ZK / E33L)
Q1DFX4 2.61e-37 131 48 2 158 3 kdpC Potassium-transporting ATPase KdpC subunit Myxococcus xanthus (strain DK1622)
B1JAS8 2.75e-37 130 44 4 184 3 kdpC Potassium-transporting ATPase KdpC subunit Pseudomonas putida (strain W619)
A6L5D0 3.22e-37 130 44 4 179 3 kdpC Potassium-transporting ATPase KdpC subunit Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
Q8A521 3.83e-37 130 39 4 192 3 kdpC Potassium-transporting ATPase KdpC subunit Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q81HP9 4.73e-37 130 41 3 186 3 kdpC Potassium-transporting ATPase KdpC subunit Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
A4YA10 5.35e-37 130 42 1 175 3 kdpC Potassium-transporting ATPase KdpC subunit Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q8NVI3 6.96e-37 129 40 4 192 3 kdpC Potassium-transporting ATPase KdpC subunit Staphylococcus aureus (strain MW2)
Q6G7N4 6.96e-37 129 40 4 192 3 kdpC Potassium-transporting ATPase KdpC subunit Staphylococcus aureus (strain MSSA476)
Q4LAI1 9.47e-37 129 40 6 195 3 kdpC Potassium-transporting ATPase KdpC subunit Staphylococcus haemolyticus (strain JCSC1435)
A8Z4X8 1.01e-36 129 40 4 192 3 kdpC Potassium-transporting ATPase KdpC subunit Staphylococcus aureus (strain USA300 / TCH1516)
P65214 1.01e-36 129 40 4 192 3 kdpC Potassium-transporting ATPase KdpC subunit Staphylococcus aureus (strain N315)
A6QIS0 1.01e-36 129 40 4 192 3 kdpC Potassium-transporting ATPase KdpC subunit Staphylococcus aureus (strain Newman)
Q2FWI1 1.01e-36 129 40 4 192 3 kdpC Potassium-transporting ATPase KdpC subunit Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FF50 1.01e-36 129 40 4 192 3 kdpC Potassium-transporting ATPase KdpC subunit Staphylococcus aureus (strain USA300)
P65213 1.01e-36 129 40 4 192 3 kdpC1 Potassium-transporting ATPase KdpC subunit 1 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q93MV4 1.21e-36 129 47 2 158 3 kdpC Potassium-transporting ATPase KdpC subunit Myxococcus xanthus
Q5HEC5 1.28e-36 129 40 4 192 3 kdpC Potassium-transporting ATPase KdpC subunit Staphylococcus aureus (strain COL)
Q1I7P1 1.28e-36 129 42 4 184 3 kdpC Potassium-transporting ATPase KdpC subunit Pseudomonas entomophila (strain L48)
Q8Y3Z8 2.37e-36 128 42 4 193 3 kdpC Potassium-transporting ATPase KdpC subunit Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
B7HDG0 3.45e-36 128 40 3 186 3 kdpC Potassium-transporting ATPase KdpC subunit Bacillus cereus (strain B4264)
P57686 3.65e-36 127 46 4 186 3 kdpC Potassium-transporting ATPase KdpC subunit Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02KC0 3.73e-36 127 46 4 186 3 kdpC Potassium-transporting ATPase KdpC subunit Pseudomonas aeruginosa (strain UCBPP-PA14)
B7II10 5.5e-36 127 41 3 186 3 kdpC Potassium-transporting ATPase KdpC subunit Bacillus cereus (strain G9842)
A9VFM2 5.74e-36 127 40 3 186 3 kdpC Potassium-transporting ATPase KdpC subunit Bacillus mycoides (strain KBAB4)
A0AM15 1.64e-35 126 40 3 192 3 kdpC Potassium-transporting ATPase KdpC subunit Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
B8DAW2 2.11e-35 125 39 2 191 3 kdpC Potassium-transporting ATPase KdpC subunit Listeria monocytogenes serotype 4a (strain HCC23)
B2TMJ3 2.91e-35 125 36 2 188 3 kdpC Potassium-transporting ATPase KdpC subunit Clostridium botulinum (strain Eklund 17B / Type B)
A6H084 3.13e-35 125 39 4 187 3 kdpC Potassium-transporting ATPase KdpC subunit Flavobacterium psychrophilum (strain ATCC 49511 / DSM 21280 / CIP 103535 / JIP02/86)
Q71W91 3.9e-35 125 40 4 193 3 kdpC Potassium-transporting ATPase KdpC subunit Listeria monocytogenes serotype 4b (strain F2365)
C1KZN4 3.9e-35 125 40 4 193 3 kdpC Potassium-transporting ATPase KdpC subunit Listeria monocytogenes serotype 4b (strain CLIP80459)
Q186E8 8.5e-35 125 36 2 201 3 kdpC Potassium-transporting ATPase KdpC subunit Clostridioides difficile (strain 630)
P73869 2.06e-34 123 46 6 180 3 kdpC Potassium-transporting ATPase KdpC subunit Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P94606 3.14e-34 123 34 2 193 2 kdpC Potassium-transporting ATPase KdpC subunit Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q9R6W9 5.68e-34 122 42 5 194 3 kdpC Potassium-transporting ATPase KdpC subunit Anabaena sp. (strain L31)
Q82PI5 7.9e-34 122 38 3 197 3 kdpC Potassium-transporting ATPase KdpC subunit Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q927G1 1.32e-33 121 39 3 192 3 kdpC Potassium-transporting ATPase KdpC subunit Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q9X8Z8 3.06e-33 121 39 3 197 3 kdpC Potassium-transporting ATPase KdpC subunit Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
A3PNW1 1.72e-32 118 46 2 190 3 kdpC Potassium-transporting ATPase KdpC subunit Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
B0KNU2 3.78e-32 117 43 4 184 3 kdpC Potassium-transporting ATPase KdpC subunit Pseudomonas putida (strain GB-1)
Q8YPF1 4.15e-32 117 40 4 197 3 kdpC2 Potassium-transporting ATPase KdpC subunit 2 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q2NZA0 6.47e-32 117 41 2 179 3 kdpC Potassium-transporting ATPase KdpC subunit Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
A5FIF7 8.48e-32 116 41 4 172 3 kdpC Potassium-transporting ATPase KdpC subunit Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / BCRC 14874 / CCUG 350202 / NBRC 14942 / NCIMB 11054 / UW101)
A5N884 2.19e-31 116 35 2 179 3 kdpC Potassium-transporting ATPase KdpC subunit Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
Q8PPC8 5.78e-31 115 43 4 181 3 kdpC Potassium-transporting ATPase KdpC subunit Xanthomonas axonopodis pv. citri (strain 306)
Q8YSD7 1.06e-30 114 39 4 186 3 kdpC1 Potassium-transporting ATPase KdpC subunit 1 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q3IYD8 5.97e-30 111 45 2 190 3 kdpC Potassium-transporting ATPase KdpC subunit Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
B0JJA1 2.77e-29 110 40 6 203 3 kdpC Potassium-transporting ATPase KdpC subunit Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
B3DWJ8 4e-29 110 43 3 153 3 kdpC Potassium-transporting ATPase KdpC subunit Methylacidiphilum infernorum (isolate V4)
A6W6R7 4.63e-29 109 39 2 189 3 kdpC Potassium-transporting ATPase KdpC subunit Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216)
B2V2P4 8.33e-29 109 36 2 177 3 kdpC Potassium-transporting ATPase KdpC subunit Clostridium botulinum (strain Alaska E43 / Type E3)
B8GER0 2.3e-27 105 44 4 161 3 kdpC Potassium-transporting ATPase KdpC subunit Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c)
A7HRV5 3.15e-27 104 38 3 187 3 kdpC Potassium-transporting ATPase KdpC subunit Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
Q8F1M2 5.57e-27 104 36 2 167 3 kdpC Potassium-transporting ATPase KdpC subunit Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72TM5 5.57e-27 104 36 2 167 3 kdpC Potassium-transporting ATPase KdpC subunit Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q8PCM0 7.42e-26 102 43 4 153 3 kdpC Potassium-transporting ATPase KdpC subunit Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RVC5 7.42e-26 102 43 4 153 3 kdpC Potassium-transporting ATPase KdpC subunit Xanthomonas campestris pv. campestris (strain B100)
Q4UQV0 7.42e-26 102 43 4 153 3 kdpC Potassium-transporting ATPase KdpC subunit Xanthomonas campestris pv. campestris (strain 8004)
Q97BF5 1.26e-19 85 30 5 189 3 kdpC Potassium-transporting ATPase KdpC subunit Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1)
P57687 3.42e-19 84 36 6 182 3 kdpC Potassium-transporting ATPase KdpC subunit Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
B0R9M1 3.42e-19 84 36 6 182 2 kdpC Potassium-transporting ATPase KdpC subunit Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
P57688 1.79e-17 79 29 5 192 3 kdpC Potassium-transporting ATPase KdpC subunit Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_03965
Feature type CDS
Gene kdpC
Product potassium-transporting ATPase subunit KdpC
Location 114485 - 115075 (strand: -1)
Length 591 (nucleotides) / 196 (amino acids)
In genomic island -

Contig

Accession ZDB_681
Length 269562 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2625
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF02669 K+-transporting ATPase, c chain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2156 Inorganic ion transport and metabolism (P) P K+-transporting ATPase, KdpC subunit

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K01548 potassium-transporting ATPase KdpC subunit Two-component system -

Protein Sequence

MSQIRPAIIIFLVLALVTGVFYPLLTTSLGEWWFARQANGSLIEVNNEVKGSALIGQQFTQPGYFHGRPSETAEHPYNALSSGGSNLSTGNPELLQRVAQRAETLRAENPDASRPVPVDLVTASASGLDPDISPDAAYWQAARVAKARNMTQAEVEKLIREHITTPVPAFTGVPVVNVLALNLALDAHAADKTSLN

Flanking regions ( +/- flanking 50bp)

AATTGATAGATATGTTACTGACCCTGACAGGGTTAGTATAAGGATAAACAATGAGTCAGATACGTCCCGCAATCATAATATTTCTGGTTCTGGCACTGGTAACAGGGGTATTTTATCCTCTGCTGACCACCTCGCTCGGGGAGTGGTGGTTTGCCCGCCAGGCCAACGGCTCACTGATTGAAGTGAATAACGAAGTCAAAGGCTCGGCGCTGATCGGCCAGCAGTTCACACAGCCCGGTTATTTTCACGGACGCCCGTCAGAAACAGCAGAGCATCCGTATAACGCCCTGAGTTCCGGCGGCAGCAACCTGAGCACCGGCAACCCGGAACTGTTACAGCGGGTGGCGCAGCGGGCAGAAACATTAAGGGCGGAAAACCCGGATGCTTCCCGCCCGGTGCCGGTTGACCTGGTGACCGCCTCTGCCAGCGGGCTGGATCCGGATATCTCTCCGGATGCCGCTTACTGGCAGGCCGCGCGGGTGGCCAAAGCGCGTAATATGACACAGGCGGAGGTGGAGAAACTGATCCGCGAACATATCACCACTCCGGTGCCTGCGTTTACCGGTGTGCCGGTCGTGAATGTGCTGGCACTGAATCTGGCGCTGGATGCACATGCGGCGGACAAAACCAGCCTGAACTAACGGAAGGACAGCATTATGTATGATGAGCCACTGCGTCCCGATCCTGACCA