Homologs in group_3178

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_01220 FBDBKF_01220 100.0 Morganella morganii S1 yddA ABC-type uncharacterized transport system, permease and ATPase components
EHELCC_00325 EHELCC_00325 100.0 Morganella morganii S2 yddA ABC-type uncharacterized transport system, permease and ATPase components
NLDBIP_03135 NLDBIP_03135 100.0 Morganella morganii S4 yddA ABC-type uncharacterized transport system, permease and ATPase components
LHKJJB_04650 LHKJJB_04650 100.0 Morganella morganii S3 yddA ABC-type uncharacterized transport system, permease and ATPase components

Distribution of the homologs in the orthogroup group_3178

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3178

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P31826 2.3e-98 312 33 4 542 1 yddA Inner membrane ABC transporter ATP-binding protein YddA Escherichia coli (strain K12)
Q57335 5.71e-95 304 30 4 540 3 HI_0036 Uncharacterized ABC transporter ATP-binding protein HI_0036 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P45221 1.01e-85 280 32 12 553 3 HI_1467 Uncharacterized ABC transporter ATP-binding protein HI_1467 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P9WQI9 2.05e-85 281 34 8 494 1 bacA Hydrophilic compounds import ATP-binding/permease protein BacA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQI8 2.05e-85 281 34 8 494 3 bacA Hydrophilic compounds import ATP-binding/permease protein BacA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q55774 4.52e-75 254 34 10 508 3 sll0182 Uncharacterized ABC transporter ATP-binding protein sll0182 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q6NLC1 5.94e-67 233 28 12 612 1 ABCC2 ABC transporter D family member 2, chloroplastic Arabidopsis thaliana
O89016 7.19e-46 173 26 20 573 1 Abcd4 Lysosomal cobalamin transporter ABCD4 Mus musculus
O14678 9.03e-45 170 25 18 582 1 ABCD4 Lysosomal cobalamin transporter ABCD4 Homo sapiens
P16970 1.31e-38 153 26 16 506 1 Abcd3 ATP-binding cassette sub-family D member 3 Rattus norvegicus
P55096 3.93e-36 146 26 16 506 1 Abcd3 ATP-binding cassette sub-family D member 3 Mus musculus
P28288 4.95e-35 143 25 16 511 1 ABCD3 ATP-binding cassette sub-family D member 3 Homo sapiens
Q94FB9 3.9e-28 123 22 13 514 1 ABCD1 ABC transporter D family member 1 Arabidopsis thaliana
Q94FB9 2.59e-23 108 24 17 506 1 ABCD1 ABC transporter D family member 1 Arabidopsis thaliana
F1RBC8 1.17e-27 121 24 17 550 2 abcd1 ATP-binding cassette sub-family D member 1 Danio rerio
Q9UBJ2 2.82e-27 120 24 13 515 1 ABCD2 ATP-binding cassette sub-family D member 2 Homo sapiens
Q8T8P3 1.66e-25 114 32 7 219 3 abcD2 ABC transporter D family member 2 Dictyostelium discoideum
Q8T8P3 2.47e-10 67 24 5 271 3 abcD2 ABC transporter D family member 2 Dictyostelium discoideum
Q9QY44 2.33e-25 114 23 14 513 1 Abcd2 ATP-binding cassette sub-family D member 2 Rattus norvegicus
Q7JUN3 7.44e-25 112 24 15 528 2 Abcd1 ATP-binding cassette sub-family D member 1 Drosophila melanogaster
Q61285 8.15e-25 112 23 12 517 1 Abcd2 ATP-binding cassette sub-family D member 2 Mus musculus
P33897 1.57e-24 111 24 17 535 1 ABCD1 ATP-binding cassette sub-family D member 1 Homo sapiens
P41909 1.48e-23 108 23 18 550 1 PXA1 Peroxisomal long-chain fatty acid import protein 2 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q08120 3.53e-20 96 23 5 320 3 bacA Bacteroid development protein BacA Rhizobium meliloti (strain 1021)
P48410 1.07e-19 96 34 3 158 1 Abcd1 ATP-binding cassette sub-family D member 1 Mus musculus
D3ZHR2 1.09e-19 96 34 3 158 1 Abcd1 ATP-binding cassette sub-family D member 1 Rattus norvegicus
P0AFY6 1.24e-19 94 22 6 322 1 sbmA Peptide antibiotic transporter SbmA Escherichia coli (strain K12)
P0AFY7 1.24e-19 94 22 6 322 3 sbmA Peptide antibiotic transporter SbmA Escherichia coli O157:H7
Q54W20 2.12e-17 89 26 5 232 3 abcD3 ABC transporter D family member 3 Dictyostelium discoideum
Q54W20 0.000233 47 24 5 178 3 abcD3 ABC transporter D family member 3 Dictyostelium discoideum
Q54W19 4.15e-17 88 24 9 320 3 abcD1 ABC transporter D family member 1 Dictyostelium discoideum
P9WQJ7 3.91e-16 85 25 9 313 1 irtB Mycobactin import ATP-binding/permease protein IrtB Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQJ6 3.91e-16 85 25 9 313 3 irtB Mycobactin import ATP-binding/permease protein IrtB Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P63394 3.91e-16 85 25 9 313 3 irtB Mycobactin import ATP-binding/permease protein IrtB Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q82MV1 2.6e-15 79 37 7 162 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q7NQN5 2.13e-14 78 33 3 139 3 potA Spermidine/putrescine import ATP-binding protein PotA Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q0RKH4 2.6e-14 76 38 6 143 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Frankia alni (strain DSM 45986 / CECT 9034 / ACN14a)
Q87RE5 4.66e-14 75 32 2 144 3 znuC Zinc import ATP-binding protein ZnuC Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q13RD3 4.79e-14 75 34 4 155 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Paraburkholderia xenovorans (strain LB400)
A0R6H7 7.87e-14 77 24 13 381 1 irtB Mycobactin import ATP-binding/permease protein IrtB Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q8U8D6 9.71e-14 75 37 2 129 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q54NL1 1.85e-13 77 32 6 180 3 abcC9 ABC transporter C family member 9 Dictyostelium discoideum
Q54NL1 9.07e-09 62 31 5 151 3 abcC9 ABC transporter C family member 9 Dictyostelium discoideum
P34713 1.96e-13 77 29 3 177 2 pgp-3 Multidrug resistance protein pgp-3 Caenorhabditis elegans
P34713 4.45e-06 53 26 6 184 2 pgp-3 Multidrug resistance protein pgp-3 Caenorhabditis elegans
Q4UMZ3 3.26e-13 75 30 4 166 3 RF_0214 Putative export ATP-binding/permease protein RF_0214 Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q881U6 4.07e-13 72 35 5 159 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q8ST87 5.52e-13 75 31 3 166 3 abcC10 ABC transporter C family member 10 Dictyostelium discoideum
Q8ST87 0.000302 47 28 5 136 3 abcC10 ABC transporter C family member 10 Dictyostelium discoideum
Q3IWB5 5.65e-13 72 33 6 156 3 znuC Zinc import ATP-binding protein ZnuC Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q48FT0 5.67e-13 72 38 5 127 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q5E6M2 5.71e-13 72 31 3 161 3 znuC1 Zinc import ATP-binding protein ZnuC 1 Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q48IB9 6.03e-13 72 36 5 149 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q9X2W0 6.43e-13 75 30 4 168 1 mcjD Microcin-J25 export ATP-binding/permease protein McjD Escherichia coli
Q9Y8G1 6.47e-13 75 29 2 167 1 atrD ABC multidrug transporter atrD Emericella nidulans
Q9Y8G1 2.99e-08 60 23 19 529 1 atrD ABC multidrug transporter atrD Emericella nidulans
Q5BAY0 6.58e-13 75 29 2 167 1 atrD ABC multidrug transporter atrD Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q5BAY0 2.65e-08 60 23 19 529 1 atrD ABC multidrug transporter atrD Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q54U44 7.72e-13 75 33 3 166 3 abcC12 ABC transporter C family member 12 Dictyostelium discoideum
Q54U44 0.000189 48 28 5 136 3 abcC12 ABC transporter C family member 12 Dictyostelium discoideum
Q89ER4 7.88e-13 72 35 5 150 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q3KKA1 1.08e-12 72 32 4 143 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas fluorescens (strain Pf0-1)
Q9HT73 1.17e-12 72 31 5 157 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02DK9 1.17e-12 72 31 5 157 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas aeruginosa (strain UCBPP-PA14)
Q4ZQE3 1.26e-12 72 38 5 127 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Pseudomonas syringae pv. syringae (strain B728a)
Q1B8U4 1.75e-12 70 33 4 160 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Mycobacterium sp. (strain MCS)
Q6LTB1 1.78e-12 71 32 3 154 3 znuC Zinc import ATP-binding protein ZnuC Photobacterium profundum (strain SS9)
Q9LSJ2 1.87e-12 74 24 11 398 3 ABCB22 ABC transporter B family member 22 Arabidopsis thaliana
Q9LSJ2 6.75e-09 62 24 5 203 3 ABCB22 ABC transporter B family member 22 Arabidopsis thaliana
Q160Y9 1.94e-12 70 29 3 154 3 znuC Zinc import ATP-binding protein ZnuC Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q57213 1.95e-12 69 33 6 158 3 HI_1474 Uncharacterized ABC transporter ATP-binding protein HI_1474 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9KS33 2.16e-12 72 29 3 148 3 potA Spermidine/putrescine import ATP-binding protein PotA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q9LSJ5 2.16e-12 73 28 3 169 3 ABCB18 ABC transporter B family member 18 Arabidopsis thaliana
Q9LSJ5 8.8e-09 62 25 6 203 3 ABCB18 ABC transporter B family member 18 Arabidopsis thaliana
Q885N4 2.23e-12 71 37 5 127 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q9P7V2 2.29e-12 73 26 7 246 3 abc4 ATP-binding cassette transporter abc4 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q9P7V2 2.85e-05 50 27 5 174 3 abc4 ATP-binding cassette transporter abc4 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q3ATA4 2.37e-12 70 30 6 201 3 pstB Phosphate import ATP-binding protein PstB Chlorobium chlorochromatii (strain CaD3)
P34712 2.58e-12 73 30 3 167 1 pgp-1 Multidrug resistance protein pgp-1 Caenorhabditis elegans
P34712 6.24e-10 66 28 4 173 1 pgp-1 Multidrug resistance protein pgp-1 Caenorhabditis elegans
A0A1U9YI12 2.68e-12 73 32 6 176 2 verA ABC-type transmembrane transporter verA Clonostachys rogersoniana
A0A1U9YI12 2.48e-09 63 30 6 186 2 verA ABC-type transmembrane transporter verA Clonostachys rogersoniana
Q9LHD1 2.89e-12 73 28 2 169 3 ABCB15 ABC transporter B family member 15 Arabidopsis thaliana
Q9LHD1 2.69e-10 67 27 4 173 3 ABCB15 ABC transporter B family member 15 Arabidopsis thaliana
Q1IGY7 3.33e-12 70 32 4 143 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas entomophila (strain L48)
Q4KGX6 3.46e-12 70 39 5 127 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q7MKU3 3.74e-12 71 29 3 135 3 potA Spermidine/putrescine import ATP-binding protein PotA Vibrio vulnificus (strain YJ016)
Q8D9J4 3.74e-12 71 29 3 135 3 potA Spermidine/putrescine import ATP-binding protein PotA Vibrio vulnificus (strain CMCP6)
P34230 4.16e-12 72 23 9 287 1 PXA2 Peroxisomal long-chain fatty acid import protein 1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q88RL1 4.33e-12 70 32 4 143 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B2KWH4 4.49e-12 72 30 3 169 2 ABC1 ABC transporter 1 Ajellomyces capsulatus
B2KWH4 7.85e-11 68 26 6 241 2 ABC1 ABC transporter 1 Ajellomyces capsulatus
Q5LUR8 4.56e-12 70 36 7 150 3 znuC Zinc import ATP-binding protein ZnuC Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q4ZTG9 5.25e-12 69 38 4 126 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Pseudomonas syringae pv. syringae (strain B728a)
Q7MMN0 5.83e-12 69 31 1 126 3 znuC Zinc import ATP-binding protein ZnuC Vibrio vulnificus (strain YJ016)
Q8DFQ4 5.83e-12 69 31 1 126 3 znuC Zinc import ATP-binding protein ZnuC Vibrio vulnificus (strain CMCP6)
Q9NP58 6.37e-12 72 24 8 262 1 ABCB6 ATP-binding cassette sub-family B member 6 Homo sapiens
Q0S0X2 6.58e-12 69 36 4 127 3 ssuB3 Aliphatic sulfonates import ATP-binding protein SsuB 3 Rhodococcus jostii (strain RHA1)
Q4KKK4 6.64e-12 69 32 4 143 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q9LSJ6 7.02e-12 72 27 2 169 3 ABCB17 ABC transporter B family member 17 Arabidopsis thaliana
Q9LSJ6 8.37e-08 59 27 6 177 3 ABCB17 ABC transporter B family member 17 Arabidopsis thaliana
Q9ZCM8 7.14e-12 71 28 6 192 3 RP696 Putative export ATP-binding/permease protein RP696 Rickettsia prowazekii (strain Madrid E)
Q8RI39 7.69e-12 70 36 7 159 3 potA Spermidine/putrescine import ATP-binding protein PotA Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q13GD4 7.79e-12 68 36 4 155 3 ssuB3 Aliphatic sulfonates import ATP-binding protein SsuB 3 Paraburkholderia xenovorans (strain LB400)
Q13ZK7 9.95e-12 70 35 6 149 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Paraburkholderia xenovorans (strain LB400)
Q665B6 1.01e-11 69 36 7 154 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Yersinia pseudotuberculosis serotype I (strain IP32953)
F2RP52 1.07e-11 71 28 2 167 2 MDR2 ABC multidrug transporter MDR2 Trichophyton tonsurans (strain CBS 112818)
F2RP52 2.85e-06 54 23 15 355 2 MDR2 ABC multidrug transporter MDR2 Trichophyton tonsurans (strain CBS 112818)
F2PRR1 1.07e-11 71 28 2 167 2 MDR2 ABC multidrug transporter MDR2 Trichophyton equinum (strain ATCC MYA-4606 / CBS 127.97)
F2PRR1 2.85e-06 54 23 15 355 2 MDR2 ABC multidrug transporter MDR2 Trichophyton equinum (strain ATCC MYA-4606 / CBS 127.97)
Q4ZZS2 1.19e-11 68 32 4 143 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas syringae pv. syringae (strain B728a)
Q87PH3 1.2e-11 70 29 3 135 3 potA Spermidine/putrescine import ATP-binding protein PotA Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q0BFQ0 1.26e-11 69 35 4 147 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q5WCI1 1.32e-11 68 34 4 133 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Shouchella clausii (strain KSM-K16)
Q1GL85 1.39e-11 68 32 6 165 3 znuC Zinc import ATP-binding protein ZnuC Ruegeria sp. (strain TM1040)
Q1CDR0 1.44e-11 68 35 7 154 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Yersinia pestis bv. Antiqua (strain Nepal516)
Q74PI5 1.44e-11 68 35 7 154 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Yersinia pestis
Q1C1S0 1.44e-11 68 35 7 154 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Yersinia pestis bv. Antiqua (strain Antiqua)
Q1CJG3 1.52e-11 68 33 6 158 3 znuC Zinc import ATP-binding protein ZnuC Yersinia pestis bv. Antiqua (strain Nepal516)
Q7CIC2 1.52e-11 68 33 6 158 3 znuC Zinc import ATP-binding protein ZnuC Yersinia pestis
Q1C812 1.52e-11 68 33 6 158 3 znuC Zinc import ATP-binding protein ZnuC Yersinia pestis bv. Antiqua (strain Antiqua)
Q39GW5 1.67e-11 69 35 5 148 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
P16876 1.78e-11 70 29 4 177 3 MDR3 Multidrug resistance protein 3 Entamoeba histolytica (strain ATCC 30459 / HM-1:IMSS / ABRM)
P16876 9.39e-08 58 29 4 168 3 MDR3 Multidrug resistance protein 3 Entamoeba histolytica (strain ATCC 30459 / HM-1:IMSS / ABRM)
Q66AT7 1.81e-11 68 33 6 158 3 znuC Zinc import ATP-binding protein ZnuC Yersinia pseudotuberculosis serotype I (strain IP32953)
Q8FVT0 1.83e-11 69 31 6 163 3 BRA0745 Putative ATP-binding protein BRA0745/BS1330_II0738 Brucella suis biovar 1 (strain 1330)
Q2YKZ7 1.9e-11 69 31 6 163 3 BAB2_0493 Putative ATP-binding protein BAB2_0493 Brucella abortus (strain 2308)
Q578M5 1.9e-11 69 31 6 163 3 BruAb2_0487 Putative ATP-binding protein BruAb2_0487 Brucella abortus biovar 1 (strain 9-941)
A1U776 2.1e-11 67 34 6 176 3 znuC Zinc import ATP-binding protein ZnuC Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q1BWL4 2.13e-11 68 35 4 147 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Burkholderia orbicola (strain AU 1054)
A0K739 2.13e-11 68 35 4 147 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Burkholderia cenocepacia (strain HI2424)
Q5E586 2.15e-11 69 29 3 135 3 potA Spermidine/putrescine import ATP-binding protein PotA Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q02R79 2.39e-11 68 32 3 139 3 potA Spermidine/putrescine import ATP-binding protein PotA Pseudomonas aeruginosa (strain UCBPP-PA14)
Q2SPI3 2.39e-11 67 32 5 156 3 znuC1 Zinc import ATP-binding protein ZnuC 1 Hahella chejuensis (strain KCTC 2396)
Q9HY19 2.43e-11 68 32 3 139 3 potA2 Spermidine/putrescine import ATP-binding protein PotA 2 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A1B9K8 2.45e-11 67 31 6 155 3 znuC Zinc import ATP-binding protein ZnuC Paracoccus denitrificans (strain Pd 1222)
A0A059JJ46 2.54e-11 70 28 2 167 2 MDR2 ABC multidrug transporter MDR2 Trichophyton interdigitale (strain MR816)
A0A059JJ46 2.69e-06 54 23 15 355 2 MDR2 ABC multidrug transporter MDR2 Trichophyton interdigitale (strain MR816)
F2T1C4 2.7e-11 70 28 2 167 1 MDR2 ABC multidrug transporter MDR2 Trichophyton rubrum (strain ATCC MYA-4607 / CBS 118892)
F2T1C4 1.5e-06 55 22 22 531 1 MDR2 ABC multidrug transporter MDR2 Trichophyton rubrum (strain ATCC MYA-4607 / CBS 118892)
Q68W42 2.74e-11 69 28 6 192 3 RT0691 Putative export ATP-binding/permease protein RT0691 Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q98DT6 3.25e-11 67 36 4 144 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q9PHQ1 3.57e-11 67 33 8 173 3 pstB Phosphate import ATP-binding protein PstB Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q8Y651 3.59e-11 67 27 5 170 3 mntB Manganese transport system ATP-binding protein MntB Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
O34338 3.6e-11 67 27 6 187 2 mntB Manganese transport system ATP-binding protein MntB Bacillus subtilis (strain 168)
Q89AJ0 3.66e-11 67 30 2 144 3 znuC Zinc import ATP-binding protein ZnuC Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
F2SQT8 3.85e-11 70 25 6 239 1 MDR5 ABC multidrug transporter MDR5 Trichophyton rubrum (strain ATCC MYA-4607 / CBS 118892)
Q1BG75 4.12e-11 67 32 5 162 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Burkholderia orbicola (strain AU 1054)
A0KE71 4.12e-11 67 32 5 162 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Burkholderia cenocepacia (strain HI2424)
Q92AF9 4.17e-11 66 27 6 172 3 mntB Manganese transport system ATP-binding protein MntB Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q9LID6 4.29e-11 69 29 9 224 2 ABCE1 ABC transporter E family member 1 Arabidopsis thaliana
Q0A9E2 4.62e-11 67 27 5 195 3 znuC Zinc import ATP-binding protein ZnuC Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q11ID5 4.75e-11 67 34 8 161 3 hmuV Hemin import ATP-binding protein HmuV Chelativorans sp. (strain BNC1)
Q5YRK2 5.11e-11 66 37 5 127 3 ssuB3 Aliphatic sulfonates import ATP-binding protein SsuB 3 Nocardia farcinica (strain IFM 10152)
Q5HVF4 5.28e-11 66 32 7 172 3 pstB Phosphate import ATP-binding protein PstB Campylobacter jejuni (strain RM1221)
Q32EY4 5.31e-11 68 29 4 135 3 potA Spermidine/putrescine import ATP-binding protein PotA Shigella dysenteriae serotype 1 (strain Sd197)
Q92GP9 5.36e-11 68 27 3 166 3 RC1073 Putative export ATP-binding/permease protein RC1073 Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q1LNM0 5.62e-11 67 35 5 143 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q1RGL1 5.69e-11 66 32 4 146 3 znuC Zinc import ATP-binding protein ZnuC Rickettsia bellii (strain RML369-C)
Q3Z2Z3 5.7e-11 68 29 4 135 3 potA Spermidine/putrescine import ATP-binding protein PotA Shigella sonnei (strain Ss046)
Q31ZK0 5.7e-11 68 29 4 135 3 potA Spermidine/putrescine import ATP-binding protein PotA Shigella boydii serotype 4 (strain Sb227)
Q8Z7H7 5.7e-11 68 31 4 140 3 potA Spermidine/putrescine import ATP-binding protein PotA Salmonella typhi
Q21XJ9 5.76e-11 67 34 4 146 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q6LR20 5.82e-11 68 30 4 135 3 potA Spermidine/putrescine import ATP-binding protein PotA Photobacterium profundum (strain SS9)
Q6CYU2 5.85e-11 66 37 5 138 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
P69877 6.23e-11 67 29 4 135 3 potA Spermidine/putrescine import ATP-binding protein PotA Shigella flexneri
P69874 6.23e-11 67 29 4 135 1 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli (strain K12)
P69875 6.23e-11 67 29 4 135 3 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TIU8 6.23e-11 67 29 4 135 3 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P69876 6.23e-11 67 29 4 135 3 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli O157:H7
Q0T5R2 6.35e-11 67 29 4 135 3 potA Spermidine/putrescine import ATP-binding protein PotA Shigella flexneri serotype 5b (strain 8401)
Q00449 6.41e-11 69 31 5 173 2 Mdr49 Multidrug resistance protein homolog 49 Drosophila melanogaster
Q00449 3.56e-08 60 26 4 187 2 Mdr49 Multidrug resistance protein homolog 49 Drosophila melanogaster
Q5PMK1 6.46e-11 67 31 4 140 3 potA Spermidine/putrescine import ATP-binding protein PotA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q1RD28 6.46e-11 67 29 4 135 3 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli (strain UTI89 / UPEC)
A1AA20 6.46e-11 67 29 4 135 3 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli O1:K1 / APEC
P40790 6.82e-11 67 31 4 140 3 potA Spermidine/putrescine import ATP-binding protein PotA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q57QC8 6.82e-11 67 31 4 140 3 potA Spermidine/putrescine import ATP-binding protein PotA Salmonella choleraesuis (strain SC-B67)
J9VF33 6.88e-11 69 33 7 172 1 MDR1 ABC multidrug transporter MDR1 Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487)
J9VF33 1.09e-06 55 25 3 174 1 MDR1 ABC multidrug transporter MDR1 Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487)
Q9ZR72 7.27e-11 68 28 5 173 1 ABCB1 ABC transporter B family member 1 Arabidopsis thaliana
Q9ZR72 1.1e-07 58 26 6 213 1 ABCB1 ABC transporter B family member 1 Arabidopsis thaliana
Q9LSJ8 8.46e-11 68 26 2 169 2 ABCB16 ABC transporter B family member 16 Arabidopsis thaliana
Q9LSJ8 3.36e-09 63 27 5 173 2 ABCB16 ABC transporter B family member 16 Arabidopsis thaliana
P16877 9.3e-11 68 30 4 174 3 MDR4 Multidrug resistance protein 4 Entamoeba histolytica (strain ATCC 30459 / HM-1:IMSS / ABRM)
P16877 7.57e-08 59 29 4 168 3 MDR4 Multidrug resistance protein 4 Entamoeba histolytica (strain ATCC 30459 / HM-1:IMSS / ABRM)
Q07LQ4 9.63e-11 66 34 6 150 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Rhodopseudomonas palustris (strain BisA53)
Q87UN0 9.97e-11 66 32 4 143 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
O06967 1.02e-10 68 30 5 168 1 bmrA Multidrug resistance ABC transporter ATP-binding/permease protein BmrA Bacillus subtilis (strain 168)
Q2SVN0 1.04e-10 67 36 4 147 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
P42360 1.13e-10 65 27 7 182 1 scaC Manganese import ATP-binding protein ScaC Streptococcus gordonii
A0A125QXJ1 1.17e-10 68 24 8 262 2 ABCB6 ATP-binding cassette sub-family B member 6 Mesocricetus auratus
Q54BU4 1.24e-10 68 26 4 168 3 abcB1 ABC transporter B family member 1 Dictyostelium discoideum
Q0VQP5 1.31e-10 67 24 11 352 3 msbA ATP-dependent lipid A-core flippase Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q48PV0 1.31e-10 65 32 4 143 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q4WTT9 1.62e-10 67 26 2 167 2 mdr1 ABC multidrug transporter mdr1 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q6D734 1.77e-10 66 32 7 177 3 fbpC1 Fe(3+) ions import ATP-binding protein FbpC 1 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q08201 1.84e-10 67 31 6 173 1 Abcb4 Phosphatidylcholine translocator ABCB4 Rattus norvegicus
Q08201 1.65e-08 61 27 4 185 1 Abcb4 Phosphatidylcholine translocator ABCB4 Rattus norvegicus
A1TXH7 1.88e-10 66 29 5 158 3 potA Spermidine/putrescine import ATP-binding protein PotA Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q6YUU5 1.89e-10 67 28 5 172 3 Os02g0190300 Putative multidrug resistance protein Oryza sativa subsp. japonica
Q6YUU5 4.92e-06 53 24 5 203 3 Os02g0190300 Putative multidrug resistance protein Oryza sativa subsp. japonica
Q5PB72 1.94e-10 64 28 5 169 3 znuC Zinc import ATP-binding protein ZnuC Anaplasma marginale (strain St. Maries)
A0LCH8 1.98e-10 65 29 3 140 3 znuC Zinc import ATP-binding protein ZnuC Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
A0A348AXX9 2.01e-10 67 30 4 170 2 kk1G ABC-type transporter kk1G Curvularia clavata
P37608 2.01e-10 67 23 14 418 3 lcnDR3 Lacticin-481/lactococcin-DR transport/processing ATP-binding protein lcnDR3 Lactococcus lactis subsp. lactis
Q8XZQ4 2.04e-10 65 37 5 138 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
A0A095C325 2.11e-10 67 32 7 173 1 MDR1 ABC multidrug transporter MDR1 Cryptococcus deuterogattii (strain R265)
A0A095C325 9.23e-06 52 25 3 174 1 MDR1 ABC multidrug transporter MDR1 Cryptococcus deuterogattii (strain R265)
Q0BUR6 2.15e-10 64 37 5 127 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
P43245 2.18e-10 67 29 9 218 2 Abcb1 ATP-dependent translocase ABCB1 Rattus norvegicus
P43245 5.16e-10 66 27 4 184 2 Abcb1 ATP-dependent translocase ABCB1 Rattus norvegicus
Q8LPK2 2.3e-10 67 27 4 173 1 ABCB2 ABC transporter B family member 2 Arabidopsis thaliana
Q8LPK2 4.35e-08 60 24 3 169 1 ABCB2 ABC transporter B family member 2 Arabidopsis thaliana
Q63TW1 2.36e-10 65 36 4 147 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Burkholderia pseudomallei (strain K96243)
Q0K9I2 2.36e-10 65 35 6 142 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
P77279 2.44e-10 64 31 6 179 1 fetA Probable iron export ATP-binding protein FetA Escherichia coli (strain K12)
Q4WA92 2.66e-10 67 25 7 262 2 abcE ABC multidrug transporter E Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q4WA92 1.3e-05 52 26 9 202 2 abcE ABC multidrug transporter E Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q58762 2.69e-10 65 28 6 166 3 wtpC Molybdate/tungstate import ATP-binding protein WtpC Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P08183 2.69e-10 67 30 8 202 1 ABCB1 ATP-dependent translocase ABCB1 Homo sapiens
P08183 4.25e-09 63 27 3 171 1 ABCB1 ATP-dependent translocase ABCB1 Homo sapiens
Q6N6K5 2.7e-10 65 36 5 147 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
P23886 2.75e-10 66 29 5 167 1 cydC Glutathione/L-cysteine transport system ATP-binding/permease protein CydC Escherichia coli (strain K12)
P45171 2.81e-10 65 30 4 147 3 potA Spermidine/putrescine import ATP-binding protein PotA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P06795 2.95e-10 67 28 2 167 1 Abcb1b ATP-dependent translocase ABCB1 Mus musculus
P06795 9.35e-10 65 29 9 218 1 Abcb1b ATP-dependent translocase ABCB1 Mus musculus
Q6BXD7 2.96e-10 66 28 7 202 3 ATM1 Iron-sulfur clusters transporter ATM1, mitochondrial Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968)
Q48CA0 2.96e-10 64 35 8 166 3 ssuB3 Aliphatic sulfonates import ATP-binding protein SsuB 3 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q9C7F8 2.98e-10 67 27 7 204 3 ABCB13 ABC transporter B family member 13 Arabidopsis thaliana
Q9C7F8 3.26e-08 60 25 4 179 3 ABCB13 ABC transporter B family member 13 Arabidopsis thaliana
Q62K56 3.05e-10 65 36 4 147 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Burkholderia mallei (strain ATCC 23344)
Q4QK57 3.11e-10 65 30 4 147 3 potA Spermidine/putrescine import ATP-binding protein PotA Haemophilus influenzae (strain 86-028NP)
Q9K8L5 3.12e-10 64 28 5 181 3 pstB Phosphate import ATP-binding protein PstB Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q6D4A8 3.18e-10 64 31 6 157 3 znuC Zinc import ATP-binding protein ZnuC Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q0AGF4 3.21e-10 65 29 5 169 3 potA Spermidine/putrescine import ATP-binding protein PotA Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q73YZ5 3.32e-10 64 34 5 159 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0QFE1 3.32e-10 64 34 5 159 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Mycobacterium avium (strain 104)
Q1RJ91 3.4e-10 66 29 4 163 3 RBE_0492 Putative export ATP-binding/permease protein RBE_0492 Rickettsia bellii (strain RML369-C)
Q4L691 3.43e-10 64 27 8 247 3 pstB Phosphate import ATP-binding protein PstB Staphylococcus haemolyticus (strain JCSC1435)
Q4K441 3.45e-10 64 34 8 166 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
P36619 3.53e-10 67 26 4 203 3 pmd1 Leptomycin B resistance protein pmd1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P36619 2.07e-06 54 26 9 234 3 pmd1 Leptomycin B resistance protein pmd1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q5NN23 3.59e-10 63 34 6 163 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q67RG2 3.8e-10 63 29 4 172 3 pstB1 Phosphate import ATP-binding protein PstB 1 Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q98G43 3.84e-10 65 30 5 163 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q61102 3.87e-10 66 28 3 179 1 Abcb7 Iron-sulfur clusters transporter ABCB7, mitochondrial Mus musculus
P46342 3.89e-10 64 29 8 188 3 pstB1 Phosphate import ATP-binding protein PstB 1 Bacillus subtilis (strain 168)
Q2J1U0 3.95e-10 65 36 6 144 3 modC Molybdenum import ATP-binding protein ModC Rhodopseudomonas palustris (strain HaA2)
Q704E8 4.08e-10 66 28 3 179 1 Abcb7 Iron-sulfur clusters transporter ABCB7, mitochondrial Rattus norvegicus
Q82VR4 4.14e-10 64 28 6 176 3 pstB Phosphate import ATP-binding protein PstB Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
G7CBF6 4.25e-10 66 29 3 168 1 irtB Mycobactin import ATP-binding/permease protein IrtB Mycolicibacterium thermoresistibile (strain ATCC 19527 / DSM 44167 / CIP 105390 / JCM 6362 / NCTC 10409 / 316)
Q3JSR6 4.26e-10 65 36 4 147 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Burkholderia pseudomallei (strain 1710b)
Q9WXX8 4.33e-10 63 33 8 160 3 TM_0124 Probable metal transport system ATP-binding protein TM_0124 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q9X196 4.35e-10 65 32 4 142 3 potA Spermidine/putrescine import ATP-binding protein PotA Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
P21449 4.5e-10 66 30 8 202 2 PGY2 Multidrug resistance protein 2 Cricetulus griseus
P21449 8.58e-10 65 27 2 167 2 PGY2 Multidrug resistance protein 2 Cricetulus griseus
O85818 4.52e-10 65 31 4 135 3 potA Spermidine/putrescine import ATP-binding protein PotA Aggregatibacter actinomycetemcomitans
Q5P1F3 4.56e-10 64 28 11 240 3 pstB Phosphate import ATP-binding protein PstB Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q98L75 4.59e-10 63 31 8 192 3 hmuV Hemin import ATP-binding protein HmuV Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q82TL6 4.79e-10 65 30 5 150 3 potA Spermidine/putrescine import ATP-binding protein PotA Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q7N8B9 5.08e-10 65 31 6 172 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q59R09 5.1e-10 66 27 6 201 3 ATM1 Iron-sulfur clusters transporter ATM1, mitochondrial Candida albicans (strain SC5314 / ATCC MYA-2876)
P21440 5.12e-10 66 30 6 173 1 Abcb4 Phosphatidylcholine translocator ABCB4 Mus musculus
P21440 1.86e-09 64 28 3 185 1 Abcb4 Phosphatidylcholine translocator ABCB4 Mus musculus
Q9KQB8 5.21e-10 63 30 1 129 3 znuC Zinc import ATP-binding protein ZnuC Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q8F6L8 5.25e-10 63 30 8 179 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
P21439 5.35e-10 66 30 6 174 1 ABCB4 Phosphatidylcholine translocator ABCB4 Homo sapiens
P21439 6.92e-08 59 27 4 192 1 ABCB4 Phosphatidylcholine translocator ABCB4 Homo sapiens
Q5WKG4 5.41e-10 63 34 4 140 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Shouchella clausii (strain KSM-K16)
Q5HAV5 5.53e-10 63 29 5 175 3 pstB Phosphate import ATP-binding protein PstB Ehrlichia ruminantium (strain Welgevonden)
Q5FFT1 5.53e-10 63 29 5 175 3 pstB Phosphate import ATP-binding protein PstB Ehrlichia ruminantium (strain Gardel)
Q21JQ9 5.62e-10 63 33 6 158 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
G5EG61 5.83e-10 66 28 5 212 2 pgp-14 P-glycoprotein 14 Caenorhabditis elegans
G5EG61 4.18e-07 57 26 3 169 2 pgp-14 P-glycoprotein 14 Caenorhabditis elegans
Q4HVU7 6.04e-10 65 21 14 400 3 ATM1 Iron-sulfur clusters transporter ATM1, mitochondrial Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
H6TB12 6.21e-10 66 28 3 169 1 mdr Sophorolipid transporter Starmerella bombicola
H6TB12 1.83e-07 58 23 11 330 1 mdr Sophorolipid transporter Starmerella bombicola
Q72PP0 6.27e-10 63 30 8 179 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q4ZLS1 6.38e-10 63 37 7 153 3 ssuB3 Aliphatic sulfonates import ATP-binding protein SsuB 3 Pseudomonas syringae pv. syringae (strain B728a)
Q9ZUU9 6.46e-10 65 30 7 193 1 ABCG3 ABC transporter G family member 3 Arabidopsis thaliana
Q6Q876 6.78e-10 65 30 7 184 2 sirA Multidrug resistance protein sirA Leptosphaeria maculans
P23174 6.87e-10 65 31 6 174 2 ABCB4 Phosphatidylcholine translocator ABCB4 Cricetulus griseus
P23174 1.33e-07 58 26 4 189 2 ABCB4 Phosphatidylcholine translocator ABCB4 Cricetulus griseus
Q8ELT4 7e-10 63 29 5 172 3 pstB Phosphate import ATP-binding protein PstB Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
C0SP98 7.22e-10 64 31 4 164 3 ykfD Putative oligopeptide transport ATP-binding protein YkfD Bacillus subtilis (strain 168)
Q2M3G0 7.38e-10 65 27 5 199 1 ABCB5 ATP-binding cassette sub-family B member 5 Homo sapiens
Q2M3G0 1.15e-05 52 25 3 170 1 ABCB5 ATP-binding cassette sub-family B member 5 Homo sapiens
Q6D4E2 7.39e-10 64 27 3 147 3 potA Spermidine/putrescine import ATP-binding protein PotA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
P21448 7.67e-10 65 29 8 205 1 ABCB1 ATP-dependent translocase ABCB1 Cricetulus griseus
P21448 1.05e-09 65 27 2 167 1 ABCB1 ATP-dependent translocase ABCB1 Cricetulus griseus
K3VYH8 7.71e-10 65 30 4 169 3 FPSE_09185 ABC transporter FPSE_09185 Fusarium pseudograminearum (strain CS3096)
K3VYH8 0.000114 48 37 0 58 3 FPSE_09185 ABC transporter FPSE_09185 Fusarium pseudograminearum (strain CS3096)
Q8PP41 7.77e-10 63 34 6 170 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Xanthomonas axonopodis pv. citri (strain 306)
Q9DC29 7.81e-10 65 24 8 262 1 Abcb6 ATP-binding cassette sub-family B member 6 Mus musculus
Q3YSK9 8.16e-10 63 26 5 166 3 znuC Zinc import ATP-binding protein ZnuC Ehrlichia canis (strain Jake)
P97998 8.23e-10 65 32 8 171 3 MDL1 ATP-dependent permease MDL1 Candida albicans
Q5E882 8.27e-10 62 33 4 139 3 thiQ Thiamine import ATP-binding protein ThiQ Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q46ZU5 8.27e-10 63 37 6 135 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q93KD4 8.47e-10 62 27 3 162 1 tupC Tungstate uptake system ATP-binding protein TupC Peptoclostridium acidaminophilum
Q7VNG4 8.71e-10 64 30 4 136 3 potA Spermidine/putrescine import ATP-binding protein PotA Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q668Q3 8.84e-10 64 30 5 164 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Yersinia pseudotuberculosis serotype I (strain IP32953)
Q8Y8T6 9.13e-10 64 28 4 156 3 potA Spermidine/putrescine import ATP-binding protein PotA Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q2JPW6 9.27e-10 63 29 8 208 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Synechococcus sp. (strain JA-2-3B'a(2-13))
Q7N545 9.4e-10 63 30 6 157 3 znuC Zinc import ATP-binding protein ZnuC Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
P9WER4 9.42e-10 65 29 7 153 3 braE ABC-type transporter braE Annulohypoxylon truncatum
A0KPH6 9.59e-10 62 30 5 158 3 znuC Zinc import ATP-binding protein ZnuC Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q1CJS9 9.67e-10 63 30 5 164 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZCM2 9.67e-10 63 30 5 164 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Yersinia pestis
Q1C607 9.67e-10 63 30 5 164 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Yersinia pestis bv. Antiqua (strain Antiqua)
Q9C7F2 9.7e-10 65 27 7 204 3 ABCB14 ABC transporter B family member 14 Arabidopsis thaliana
Q9C7F2 5.67e-07 56 25 5 197 3 ABCB14 ABC transporter B family member 14 Arabidopsis thaliana
Q8FW07 1.01e-09 63 31 4 138 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Brucella suis biovar 1 (strain 1330)
Q578E9 1.01e-09 63 31 4 138 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Brucella abortus biovar 1 (strain 9-941)
Q1M7A6 1.01e-09 62 32 6 164 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
P21447 1.01e-09 65 28 2 167 1 Abcb1a ATP-dependent translocase ABCB1 Mus musculus
P21447 2.67e-09 63 28 8 205 1 Abcb1a ATP-dependent translocase ABCB1 Mus musculus
Q4UJW5 1.07e-09 62 29 7 165 3 znuC Zinc import ATP-binding protein ZnuC Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q8DQH4 1.08e-09 62 30 6 176 1 ftsE Cell division ATP-binding protein FtsE Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
A0A0H2ZM82 1.08e-09 62 30 6 176 1 ftsE Cell division ATP-binding protein FtsE Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q8NSN2 1.12e-09 63 31 4 170 3 metN Methionine import ATP-binding protein MetN Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q9KLQ5 1.13e-09 63 28 3 157 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P45861 1.16e-09 64 28 5 177 1 ywjA Uncharacterized ABC transporter ATP-binding protein YwjA Bacillus subtilis (strain 168)
Q2YKR8 1.19e-09 63 31 4 138 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Brucella abortus (strain 2308)
Q0SVB6 1.21e-09 62 27 9 201 3 pstB Phosphate import ATP-binding protein PstB Clostridium perfringens (strain SM101 / Type A)
Q8XMP8 1.21e-09 62 27 9 201 3 pstB Phosphate import ATP-binding protein PstB Clostridium perfringens (strain 13 / Type A)
Q0TTG6 1.21e-09 62 27 9 201 3 pstB Phosphate import ATP-binding protein PstB Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q0P9C4 1.21e-09 64 29 4 167 1 pglK Protein glycosylation K Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q8RCU0 1.26e-09 62 32 5 150 3 pstB1 Phosphate import ATP-binding protein PstB 1 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
O70595 1.29e-09 64 24 8 262 1 Abcb6 ATP-binding cassette sub-family B member 6 Rattus norvegicus
Q9HYG4 1.41e-09 62 36 5 138 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q6MU19 1.43e-09 63 29 4 149 3 potA Spermidine/putrescine import ATP-binding protein PotA Mycoplasma mycoides subsp. mycoides SC (strain CCUG 32753 / NCTC 10114 / PG1)
Q3KCC5 1.44e-09 63 33 6 156 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Pseudomonas fluorescens (strain Pf0-1)
Q9SGY1 1.49e-09 64 27 4 173 1 ABCB10 ABC transporter B family member 10 Arabidopsis thaliana
Q9SGY1 8.25e-07 55 24 3 169 1 ABCB10 ABC transporter B family member 10 Arabidopsis thaliana
Q88ZJ6 1.52e-09 63 28 5 156 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q54EK2 1.53e-09 64 28 5 198 3 abcC7 ABC transporter C family member 7 Dictyostelium discoideum
Q54EK2 2.02e-07 57 33 5 131 3 abcC7 ABC transporter C family member 7 Dictyostelium discoideum
Q4PH16 1.57e-09 64 22 12 361 3 ATM1 Iron-sulfur clusters transporter ATM1, mitochondrial Ustilago maydis (strain 521 / FGSC 9021)
Q87UI3 1.63e-09 62 37 7 153 3 ssuB3 Aliphatic sulfonates import ATP-binding protein SsuB 3 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q8YCB1 1.65e-09 63 31 4 138 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q47A37 1.66e-09 62 28 5 174 3 pstB Phosphate import ATP-binding protein PstB Dechloromonas aromatica (strain RCB)
Q2YAD6 1.77e-09 63 29 8 195 3 potA Spermidine/putrescine import ATP-binding protein PotA Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
P33311 1.8e-09 64 31 10 204 1 MDL2 ATP-dependent permease MDL2, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
A0A0D1BUH6 1.81e-09 64 30 7 195 2 atr1 ABC-type transporter atr1 Ustilago maydis (strain 521 / FGSC 9021)
A0A0D1BUH6 7.36e-06 52 28 4 170 2 atr1 ABC-type transporter atr1 Ustilago maydis (strain 521 / FGSC 9021)
Q2SJY7 1.86e-09 63 29 5 136 3 potA Spermidine/putrescine import ATP-binding protein PotA Hahella chejuensis (strain KCTC 2396)
Q1RDS4 1.93e-09 62 36 5 133 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Escherichia coli (strain UTI89 / UPEC)
A1A9L0 1.93e-09 62 36 5 133 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Escherichia coli O1:K1 / APEC
Q7VLS9 1.95e-09 62 29 2 157 3 znuC Zinc import ATP-binding protein ZnuC Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q8A1M1 2e-09 61 28 6 177 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q2SSS4 2.02e-09 63 28 4 149 3 potA Spermidine/putrescine import ATP-binding protein PotA Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
Q8FJ95 2.04e-09 62 36 5 133 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8NR42 2.04e-09 61 36 4 144 1 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q3K506 2.09e-09 62 34 8 166 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Pseudomonas fluorescens (strain Pf0-1)
Q00748 2.11e-09 64 30 4 168 1 Mdr65 Multidrug resistance protein homolog 65 Drosophila melanogaster
Q00748 3.1e-09 63 27 2 168 1 Mdr65 Multidrug resistance protein homolog 65 Drosophila melanogaster
P54718 2.11e-09 63 27 8 244 3 yfiB Uncharacterized ABC transporter ATP-binding protein YfiB Bacillus subtilis (strain 168)
Q57SD6 2.22e-09 63 29 4 157 3 phnT Putative 2-aminoethylphosphonate import ATP-binding protein PhnT Salmonella choleraesuis (strain SC-B67)
Q4WT65 2.29e-09 64 30 5 155 2 abcB ABC multidrug transporter B Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q4WT65 4.11e-05 50 26 4 164 2 abcB ABC multidrug transporter B Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q1R597 2.3e-09 62 31 9 183 3 hmuV Hemin import ATP-binding protein HmuV Escherichia coli (strain UTI89 / UPEC)
Q6LKD4 2.34e-09 62 29 4 157 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Photobacterium profundum (strain SS9)
O34314 2.37e-09 62 33 4 151 3 ytlC Uncharacterized ABC transporter ATP-binding protein YtlC Bacillus subtilis (strain 168)
Q5E0F2 2.39e-09 63 28 4 183 3 msbA ATP-dependent lipid A-core flippase Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q2GFZ6 2.41e-09 61 26 4 149 3 znuC Zinc import ATP-binding protein ZnuC Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas)
Q9FWX7 2.56e-09 63 26 7 203 2 ABCB11 ABC transporter B family member 11 Arabidopsis thaliana
Q9FWX7 4.08e-07 57 25 6 224 2 ABCB11 ABC transporter B family member 11 Arabidopsis thaliana
Q73GK9 2.58e-09 61 24 5 161 3 znuC Zinc import ATP-binding protein ZnuC Wolbachia pipientis wMel
Q57293 2.63e-09 62 30 4 154 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Actinobacillus pleuropneumoniae
Q21UI2 2.73e-09 62 30 4 146 3 modC Molybdenum import ATP-binding protein ModC Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q9M1Q9 2.77e-09 63 27 5 173 1 ABCB21 ABC transporter B family member 21 Arabidopsis thaliana
Q9M1Q9 4.75e-08 60 26 4 170 1 ABCB21 ABC transporter B family member 21 Arabidopsis thaliana
A0AGP9 2.79e-09 62 28 4 156 3 potA Spermidine/putrescine import ATP-binding protein PotA Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
A1JRI2 2.82e-09 61 30 5 157 3 znuC Zinc import ATP-binding protein ZnuC Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
O75027 2.86e-09 63 27 3 179 1 ABCB7 Iron-sulfur clusters transporter ABCB7, mitochondrial Homo sapiens
P68580 2.91e-09 63 26 7 204 3 sunT Sublancin-168-processing and transport ATP-binding protein sunT Bacillus phage SPbeta
P68579 2.91e-09 63 26 7 204 3 sunT SPbeta prophage-derived sublancin-168-processing and transport ATP-binding protein SunT Bacillus subtilis (strain 168)
Q02QT1 2.96e-09 61 36 5 138 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Pseudomonas aeruginosa (strain UCBPP-PA14)
Q13CI6 2.97e-09 62 35 7 145 3 modC Molybdenum import ATP-binding protein ModC Rhodopseudomonas palustris (strain BisB5)
Q57554 3.03e-09 61 30 5 146 3 MJ0089 Uncharacterized ABC transporter ATP-binding protein MJ0089 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q67RE7 3.05e-09 61 31 7 173 3 pstB2 Phosphate import ATP-binding protein PstB 2 Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q8D385 3.09e-09 61 31 1 125 3 znuC Zinc import ATP-binding protein ZnuC Wigglesworthia glossinidia brevipalpis
S0EGU4 3.1e-09 63 27 12 262 2 BEA3 ABC transporter BEA3 Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831)
Q0TJC1 3.12e-09 61 35 5 133 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q28VN1 3.16e-09 61 29 6 158 3 znuC Zinc import ATP-binding protein ZnuC Jannaschia sp. (strain CCS1)
Q4WSI1 3.17e-09 63 28 4 187 2 mdr4 ABC multidrug transporter mdr4 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q4WSI1 1.09e-06 55 26 7 194 2 mdr4 ABC multidrug transporter mdr4 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q64SQ6 3.27e-09 63 28 5 155 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacteroides fragilis (strain YCH46)
Q56A55 3.34e-09 63 24 18 455 2 abcb8 Mitochondrial potassium channel ATP-binding subunit Danio rerio
Q92UV5 3.4e-09 62 31 5 135 3 fbpC2 Fe(3+) ions import ATP-binding protein FbpC 2 Rhizobium meliloti (strain 1021)
Q21PQ7 3.5e-09 61 29 6 164 3 znuC Zinc import ATP-binding protein ZnuC Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q92G36 3.51e-09 60 29 7 165 3 znuC Zinc import ATP-binding protein ZnuC Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q9FWX8 3.54e-09 63 27 7 203 2 ABCB12 ABC transporter B family member 12 Arabidopsis thaliana
Q9FWX8 4.44e-07 57 25 7 226 2 ABCB12 ABC transporter B family member 12 Arabidopsis thaliana
Q8UI76 3.58e-09 61 26 8 201 3 pstB Phosphate import ATP-binding protein PstB Agrobacterium fabrum (strain C58 / ATCC 33970)
Q5LBT4 3.6e-09 62 28 5 155 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
Q7UX73 3.61e-09 60 28 6 166 3 lolD1 Lipoprotein-releasing system ATP-binding protein LolD 1 Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
P16875 3.65e-09 63 28 4 174 3 MDR1 Multidrug resistance protein 1 Entamoeba histolytica (strain ATCC 30459 / HM-1:IMSS / ABRM)
P16875 4.08e-08 60 29 4 168 3 MDR1 Multidrug resistance protein 1 Entamoeba histolytica (strain ATCC 30459 / HM-1:IMSS / ABRM)
Q5GRS1 3.67e-09 61 27 4 148 3 znuC Zinc import ATP-binding protein ZnuC Wolbachia sp. subsp. Brugia malayi (strain TRS)
Q8A883 3.68e-09 62 26 6 183 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
P37009 3.69e-09 62 31 5 169 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Escherichia coli (strain K12)
Q32HA3 3.72e-09 61 32 5 146 3 znuC Zinc import ATP-binding protein ZnuC Shigella dysenteriae serotype 1 (strain Sd197)
Q7NN36 3.73e-09 61 32 7 162 3 hmuV Hemin import ATP-binding protein HmuV Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
P96063 3.83e-09 62 29 4 157 2 phnT Putative 2-aminoethylphosphonate import ATP-binding protein PhnT Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q1H377 3.86e-09 61 28 7 177 3 pstB Phosphate import ATP-binding protein PstB Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q2HIE9 4.02e-09 63 26 7 199 3 ATM1 Iron-sulfur clusters transporter ATM1, mitochondrial Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970)
Q2GJA5 4.06e-09 60 27 4 176 3 znuC Zinc import ATP-binding protein ZnuC Anaplasma phagocytophilum (strain HZ)
Q56927 4.06e-09 62 30 5 164 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Yersinia enterocolitica
P21958 4.21e-09 63 30 6 187 1 Tap1 Antigen peptide transporter 1 Mus musculus
Q8VZZ4 4.26e-09 63 27 5 186 2 ABCC6 ABC transporter C family member 6 Arabidopsis thaliana
Q8Z8W8 4.34e-09 62 29 4 157 3 phnT Putative 2-aminoethylphosphonate import ATP-binding protein PhnT Salmonella typhi
Q9LZB8 4.37e-09 62 21 22 573 1 ABCB29 ABC transporter B family member 29, chloroplastic Arabidopsis thaliana
Q7AH43 4.5e-09 62 30 5 169 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Escherichia coli O157:H7
Q8KZQ6 4.5e-09 61 36 6 138 1 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Pseudomonas putida
Q5PFQ7 4.54e-09 62 29 4 157 3 phnT Putative 2-aminoethylphosphonate import ATP-binding protein PhnT Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q54BT3 4.56e-09 63 28 3 167 3 abcB2 ABC transporter B family member 2 Dictyostelium discoideum
Q54BT3 5.73e-08 59 26 3 167 3 abcB2 ABC transporter B family member 2 Dictyostelium discoideum
Q0RT43 4.57e-09 61 32 4 134 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Frankia alni (strain DSM 45986 / CECT 9034 / ACN14a)
Q3Z2L6 4.65e-09 60 32 5 146 3 znuC Zinc import ATP-binding protein ZnuC Shigella sonnei (strain Ss046)
Q322E8 4.65e-09 60 32 5 146 3 znuC Zinc import ATP-binding protein ZnuC Shigella boydii serotype 4 (strain Sb227)
Q1RAS6 4.65e-09 60 32 5 146 3 znuC Zinc import ATP-binding protein ZnuC Escherichia coli (strain UTI89 / UPEC)
P0A9X1 4.65e-09 60 32 5 146 1 znuC Zinc import ATP-binding protein ZnuC Escherichia coli (strain K12)
P0A9X2 4.65e-09 60 32 5 146 3 znuC Zinc import ATP-binding protein ZnuC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TGX4 4.65e-09 60 32 5 146 3 znuC Zinc import ATP-binding protein ZnuC Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AC19 4.65e-09 60 32 5 146 3 znuC Zinc import ATP-binding protein ZnuC Escherichia coli O1:K1 / APEC
P0A9X3 4.65e-09 60 32 5 146 3 znuC Zinc import ATP-binding protein ZnuC Escherichia coli O157:H7
Q9CHL8 4.71e-09 62 25 9 272 1 lmrA Multidrug resistance ABC transporter ATP-binding and permease protein Lactococcus lactis subsp. lactis (strain IL1403)
Q1M8R6 4.77e-09 62 32 5 139 3 ugpC2 sn-glycerol-3-phosphate import ATP-binding protein UgpC 2 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q6C6N0 4.78e-09 62 27 5 187 3 ATM1 Iron-sulfur clusters transporter ATM1, mitochondrial Yarrowia lipolytica (strain CLIB 122 / E 150)
Q8UB29 4.84e-09 62 32 3 134 3 ugpC3 sn-glycerol-3-phosphate import ATP-binding protein UgpC 3 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q7N8V0 4.94e-09 60 31 6 172 3 thiQ Thiamine import ATP-binding protein ThiQ Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A1B9Q7 5.01e-09 62 34 5 138 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Paracoccus denitrificans (strain Pd 1222)
Q9FHF1 5.01e-09 63 27 6 197 3 ABCB7 ABC transporter B family member 7 Arabidopsis thaliana
Q9FHF1 7.43e-08 59 25 3 166 3 ABCB7 ABC transporter B family member 7 Arabidopsis thaliana
S3D778 5.04e-09 63 27 7 203 3 gloK ABC transporter gloK Glarea lozoyensis (strain ATCC 20868 / MF5171)
S3D778 4.45e-05 50 26 5 148 3 gloK ABC transporter gloK Glarea lozoyensis (strain ATCC 20868 / MF5171)
P97027 5.1e-09 60 31 5 145 1 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Bacillus subtilis (strain 168)
O70127 5.26e-09 63 28 3 167 1 Abcb11 Bile salt export pump Rattus norvegicus
O70127 0.000118 48 26 10 218 1 Abcb11 Bile salt export pump Rattus norvegicus
Q4WPP6 5.31e-09 62 29 5 171 2 mdr2 ABC multidrug transporter mdr2 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
A0A142I732 5.49e-09 63 31 5 149 3 phomO' ABC-type transporter phomO' Diaporthe leptostromiformis
O80725 5.5e-09 63 27 5 173 1 ABCB4 ABC transporter B family member 4 Arabidopsis thaliana
O80725 3.58e-08 60 27 4 170 1 ABCB4 ABC transporter B family member 4 Arabidopsis thaliana
Q5KX47 5.52e-09 60 29 7 174 3 pstB Phosphate import ATP-binding protein PstB Geobacillus kaustophilus (strain HTA426)
Q9QY30 5.58e-09 63 28 3 167 1 Abcb11 Bile salt export pump Mus musculus
Q9QY30 0.000179 48 28 6 171 1 Abcb11 Bile salt export pump Mus musculus
Q0SK28 5.82e-09 60 32 2 143 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Rhodococcus jostii (strain RHA1)
P0CL92 5.94e-09 62 23 16 381 3 ATM1 Iron-sulfur clusters transporter ATM1, mitochondrial Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)
B5X0E4 5.96e-09 62 26 5 202 2 Abcb5 ATP-binding cassette sub-family B member 5 Mus musculus
B5X0E4 2.36e-05 51 25 5 170 2 Abcb5 ATP-binding cassette sub-family B member 5 Mus musculus
Q12XW6 6.02e-09 60 29 7 195 3 pstB Phosphate import ATP-binding protein PstB Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M)
P0CL93 6.04e-09 62 23 16 381 3 ATM1 Iron-sulfur clusters transporter ATM1, mitochondrial Cryptococcus neoformans var. neoformans serotype D (strain B-3501A)
Q2SB47 6.38e-09 60 31 8 164 3 hmuV Hemin import ATP-binding protein HmuV Hahella chejuensis (strain KCTC 2396)
Q39LW7 6.46e-09 60 33 3 142 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q0S6U9 6.67e-09 60 33 4 146 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Rhodococcus jostii (strain RHA1)
Q8GDV4 6.68e-09 60 28 9 202 3 pstB Phosphate import ATP-binding protein PstB (Fragment) Heliobacterium mobile
Q6LV32 6.74e-09 60 31 9 174 3 thiQ Thiamine import ATP-binding protein ThiQ Photobacterium profundum (strain SS9)
Q88R93 7e-09 60 33 8 166 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q8FRX8 7e-09 61 30 6 181 3 metN Methionine import ATP-binding protein MetN Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q28K97 7.12e-09 60 31 6 163 3 tauB Taurine import ATP-binding protein TauB Jannaschia sp. (strain CCS1)
P69880 7.37e-09 60 29 7 175 3 pstB Phosphate import ATP-binding protein PstB Staphylococcus aureus (strain MW2)
Q6G9H4 7.37e-09 60 29 7 175 3 pstB Phosphate import ATP-binding protein PstB Staphylococcus aureus (strain MSSA476)
P69879 7.37e-09 60 29 7 175 3 pstB Phosphate import ATP-binding protein PstB Staphylococcus aureus (strain N315)
P69878 7.37e-09 60 29 7 175 3 pstB Phosphate import ATP-binding protein PstB Staphylococcus aureus (strain Mu50 / ATCC 700699)
P69881 7.37e-09 60 29 7 175 3 pstB Phosphate import ATP-binding protein PstB Staphylococcus aureus (strain COL)
Q2FYQ0 7.37e-09 60 29 7 175 3 pstB Phosphate import ATP-binding protein PstB Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH51 7.37e-09 60 29 7 175 3 pstB Phosphate import ATP-binding protein PstB Staphylococcus aureus (strain USA300)
P71355 7.38e-09 62 27 5 173 3 HI_0663 Uncharacterized ABC transporter ATP-binding protein HI_0663 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9CMG7 7.46e-09 62 25 5 205 3 msbA ATP-dependent lipid A-core flippase Pasteurella multocida (strain Pm70)
O14286 7.67e-09 62 28 6 187 3 atm1 Iron-sulfur clusters transporter atm1, mitochondrial Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q722B1 8.2e-09 61 27 4 156 3 potA Spermidine/putrescine import ATP-binding protein PotA Listeria monocytogenes serotype 4b (strain F2365)
P31134 8.24e-09 61 32 5 139 1 potG Putrescine transport ATP-binding protein PotG Escherichia coli (strain K12)
Q3IX40 8.47e-09 61 32 4 137 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q92SA1 8.5e-09 60 28 7 180 3 pstB Phosphate import ATP-binding protein PstB Rhizobium meliloti (strain 1021)
Q92DL6 8.58e-09 61 27 4 156 3 potA Spermidine/putrescine import ATP-binding protein PotA Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
P38735 8.6e-09 62 25 12 298 2 VMR1 ABC transporter ATP-binding protein/permease VMR1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
J9VWU3 8.67e-09 62 22 13 372 2 ATM1 Iron-sulfur clusters transporter ATM1, mitochondrial Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487)
Q47YG8 8.93e-09 60 29 8 181 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q5HBR8 8.93e-09 59 29 8 176 3 znuC Zinc import ATP-binding protein ZnuC Ehrlichia ruminantium (strain Welgevonden)
Q5FHB0 8.93e-09 59 29 8 176 3 znuC Zinc import ATP-binding protein ZnuC Ehrlichia ruminantium (strain Gardel)
Q2YXY2 9.09e-09 60 29 7 175 3 pstB Phosphate import ATP-binding protein PstB Staphylococcus aureus (strain bovine RF122 / ET3-1)
O57872 9.12e-09 60 27 7 186 3 PH0132 Putative ABC transporter ATP-binding protein PH0132 Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q8UII7 9.13e-09 61 31 4 138 3 ugpC1 sn-glycerol-3-phosphate import ATP-binding protein UgpC 1 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q3B3H7 9.6e-09 60 30 6 174 3 pstB Phosphate import ATP-binding protein PstB Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
Q180A5 9.81e-09 60 26 6 197 3 pstB Phosphate import ATP-binding protein PstB Clostridioides difficile (strain 630)
Q8U4L3 9.91e-09 60 27 8 191 3 PF0068 Putative ABC transporter ATP-binding protein PF0068 Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q08D64 1.01e-08 62 25 5 209 2 abcb6 ATP-binding cassette sub-family B member 6 Xenopus tropicalis
O57896 1.03e-08 60 32 5 147 3 wtpC Molybdate/tungstate import ATP-binding protein WtpC Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q8FCJ1 1.03e-08 60 31 9 183 3 hmuV Hemin import ATP-binding protein HmuV Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TBU8 1.03e-08 60 31 9 183 3 hmuV Hemin import ATP-binding protein HmuV Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P56344 1.04e-08 59 34 5 148 3 cysA Probable sulfate/thiosulfate import ATP-binding protein CysA Chlorella vulgaris
Q6GH21 1.04e-08 60 29 7 175 3 pstB Phosphate import ATP-binding protein PstB Staphylococcus aureus (strain MRSA252)
Q0I354 1.06e-08 59 29 5 159 3 thiQ Thiamine import ATP-binding protein ThiQ Histophilus somni (strain 129Pt)
O70014 1.07e-08 59 31 9 183 1 hmuV Hemin import ATP-binding protein HmuV Shigella dysenteriae
Q9V2E4 1.08e-08 60 28 5 168 3 PYRAB01300 Putative ABC transporter ATP-binding protein PYRAB01300 Pyrococcus abyssi (strain GE5 / Orsay)
Q65S66 1.1e-08 60 30 4 154 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q32AY3 1.1e-08 59 31 9 183 3 hmuV Hemin import ATP-binding protein HmuV Shigella dysenteriae serotype 1 (strain Sd197)
D4GP38 1.11e-08 60 29 4 141 1 xacJ Xylose/arabinose import ATP-binding protein XacJ Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
Q3AAA4 1.11e-08 59 29 6 179 3 pstB Phosphate import ATP-binding protein PstB Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q8X5N2 1.17e-08 59 31 9 183 3 hmuV Hemin import ATP-binding protein HmuV Escherichia coli O157:H7
Q46BM0 1.19e-08 59 29 7 185 3 pstB Phosphate import ATP-binding protein PstB Methanosarcina barkeri (strain Fusaro / DSM 804)
A3PRY1 1.3e-08 60 32 4 137 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
Q7GB25 1.39e-08 61 28 8 211 2 ABCC5 ABC transporter C family member 5 Arabidopsis thaliana
Q7GB25 2.02e-05 51 21 15 387 2 ABCC5 ABC transporter C family member 5 Arabidopsis thaliana
Q16BJ3 1.43e-08 59 32 7 163 3 tauB Taurine import ATP-binding protein TauB Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q4WLN7 1.44e-08 61 28 8 190 3 atm1 Iron-sulfur clusters transporter atm1, mitochondrial Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
P54537 1.54e-08 59 28 5 157 1 artM Arginine transport ATP-binding protein ArtM Bacillus subtilis (strain 168)
O95342 1.61e-08 61 28 3 167 1 ABCB11 Bile salt export pump Homo sapiens
O95342 1.04e-05 52 28 6 169 1 ABCB11 Bile salt export pump Homo sapiens
Q28QF9 1.68e-08 59 31 8 174 3 hmuV Hemin import ATP-binding protein HmuV Jannaschia sp. (strain CCS1)
Q82CD3 1.68e-08 59 34 5 142 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q65HC0 1.69e-08 59 32 7 154 3 pstB1 Phosphate import ATP-binding protein PstB 1 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q2KCV5 1.69e-08 59 27 7 179 3 pstB Phosphate import ATP-binding protein PstB Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q8RGC8 1.74e-08 60 30 4 134 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q4FMG5 1.75e-08 59 29 4 163 3 tauB Taurine import ATP-binding protein TauB Pelagibacter ubique (strain HTCC1062)
Q1D382 1.77e-08 58 30 6 189 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Myxococcus xanthus (strain DK1622)
Q5WBL0 1.78e-08 58 34 5 147 3 ssuB3 Aliphatic sulfonates import ATP-binding protein SsuB 3 Shouchella clausii (strain KSM-K16)
Q8UBB7 1.8e-08 60 28 6 171 3 ugpC2 sn-glycerol-3-phosphate import ATP-binding protein UgpC 2 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q0VL18 1.88e-08 59 28 11 211 3 pstB Phosphate import ATP-binding protein PstB Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q4L885 1.94e-08 59 28 7 181 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus haemolyticus (strain JCSC1435)
Q13TV1 1.96e-08 60 33 4 135 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Paraburkholderia xenovorans (strain LB400)
Q47T99 1.97e-08 60 29 3 135 3 potA Spermidine/putrescine import ATP-binding protein PotA Thermobifida fusca (strain YX)
Q74E68 1.99e-08 58 27 6 176 3 pstB Phosphate import ATP-binding protein PstB Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q31FG2 2.06e-08 60 25 5 189 3 msbA ATP-dependent lipid A-core flippase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q1IGL4 2.19e-08 58 36 6 138 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Pseudomonas entomophila (strain L48)
Q2K6L3 2.22e-08 59 31 4 138 3 ugpC1 sn-glycerol-3-phosphate import ATP-binding protein UgpC 1 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q9SYI3 2.23e-08 60 25 2 167 3 ABCB5 ABC transporter B family member 5 Arabidopsis thaliana
Q9SYI3 1.02e-07 58 26 7 194 3 ABCB5 ABC transporter B family member 5 Arabidopsis thaliana
Q830W6 2.25e-08 60 25 5 156 3 potA Spermidine/putrescine import ATP-binding protein PotA Enterococcus faecalis (strain ATCC 700802 / V583)
Q9V2C0 2.27e-08 59 29 7 156 3 wtpC Molybdate/tungstate import ATP-binding protein WtpC Pyrococcus abyssi (strain GE5 / Orsay)
Q160G4 2.32e-08 58 28 8 175 3 hmuV Hemin import ATP-binding protein HmuV Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q2J220 2.42e-08 58 26 8 232 3 pstB Phosphate import ATP-binding protein PstB Rhodopseudomonas palustris (strain HaA2)
O88563 2.43e-08 60 24 7 229 1 Abcc3 ATP-binding cassette sub-family C member 3 Rattus norvegicus
O88563 9.03e-07 55 29 3 172 1 Abcc3 ATP-binding cassette sub-family C member 3 Rattus norvegicus
Q54VJ0 2.47e-08 60 33 2 128 3 abcC2 ABC transporter C family member 2 Dictyostelium discoideum
Q9KQW9 2.49e-08 60 25 6 214 1 msbA ATP-dependent lipid A-core flippase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P52218 2.52e-08 58 31 5 157 1 ccmA Cytochrome c biogenesis ATP-binding export protein CcmA Paracoccus denitrificans (strain Pd 1222)
P0A2V9 2.55e-08 58 28 7 186 1 pstB3 Phosphate import ATP-binding protein PstB 3 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A2V8 2.55e-08 58 28 7 186 3 pstB3 Phosphate import ATP-binding protein PstB 3 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q83KR7 2.6e-08 58 32 5 146 3 znuC Zinc import ATP-binding protein ZnuC Shigella flexneri
Q0T3U8 2.6e-08 58 32 5 146 3 znuC Zinc import ATP-binding protein ZnuC Shigella flexneri serotype 5b (strain 8401)
Q4FQ27 2.63e-08 58 31 5 142 3 znuC Zinc import ATP-binding protein ZnuC Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q64SM5 2.63e-08 58 26 5 171 3 pstB Phosphate import ATP-binding protein PstB Bacteroides fragilis (strain YCH46)
Q5LBQ4 2.63e-08 58 26 5 171 3 pstB Phosphate import ATP-binding protein PstB Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
Q6D645 2.74e-08 58 31 8 167 3 hmuV Hemin import ATP-binding protein HmuV Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
I1S2J9 2.75e-08 60 31 6 140 1 FGM5 ABC transporter FGM5 Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
Q9LK62 2.75e-08 60 28 4 172 1 ABCC7 ABC transporter C family member 7 Arabidopsis thaliana
Q92WD6 2.76e-08 59 30 4 138 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Rhizobium meliloti (strain 1021)
Q6FFL0 2.86e-08 58 30 6 172 3 znuC Zinc import ATP-binding protein ZnuC Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q2G506 2.9e-08 60 29 4 170 1 atm1 ATM1-type heavy metal exporter Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
Q0RAT5 2.95e-08 60 31 6 158 3 potA Spermidine/putrescine import ATP-binding protein PotA Frankia alni (strain DSM 45986 / CECT 9034 / ACN14a)
Q9X0Y8 2.99e-08 58 28 6 175 3 pstB Phosphate import ATP-binding protein PstB Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q5RFQ9 3.14e-08 60 33 2 119 2 ABCB8 Mitochondrial potassium channel ATP-binding subunit Pongo abelii
Q8ELR4 3.17e-08 59 27 3 134 3 potA Spermidine/putrescine import ATP-binding protein PotA Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q8KDZ5 3.17e-08 58 31 8 175 3 pstB Phosphate import ATP-binding protein PstB Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q5V0G3 3.24e-08 58 28 8 195 3 pstB2 Phosphate import ATP-binding protein PstB 2 Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
Q8CPN0 3.26e-08 59 26 5 156 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HQ70 3.29e-08 59 26 5 156 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q1MQ44 3.32e-08 59 30 3 139 3 potA Spermidine/putrescine import ATP-binding protein PotA Lawsonia intracellularis (strain PHE/MN1-00)
Q5PJL1 3.32e-08 59 31 6 163 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q5HPF5 3.34e-08 58 28 7 178 3 pstB Phosphate import ATP-binding protein PstB Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q57180 3.41e-08 60 25 3 172 3 HI_1051 Uncharacterized ABC transporter ATP-binding protein HI_1051 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A1WXT0 3.44e-08 58 30 5 158 3 znuC Zinc import ATP-binding protein ZnuC Halorhodospira halophila (strain DSM 244 / SL1)
Q0ASG3 3.51e-08 58 30 9 188 3 pstB Phosphate import ATP-binding protein PstB Maricaulis maris (strain MCS10)
Q9M0G9 3.54e-08 60 28 6 188 1 ABCB24 ABC transporter B family member 24, mitochondrial Arabidopsis thaliana
G5EFD4 3.56e-08 60 27 6 188 2 hmt-1 Heavy metal tolerance factor 1 Caenorhabditis elegans
P45081 3.6e-08 60 26 3 167 3 cydC Glutathione/L-cysteine transport system ATP-binding/permease protein CydC Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_02395
Feature type CDS
Gene yddA
Product ABC-type uncharacterized transport system, permease and ATPase components
Location 78718 - 80403 (strand: 1)
Length 1686 (nucleotides) / 561 (amino acids)
In genomic island -

Contig

Accession ZDB_680
Length 282413 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3178
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Domains

PF00005 ABC transporter
PF06472 ABC transporter transmembrane region 2

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4178 General function prediction only (R) R ABC-type uncharacterized transport system, permease and ATPase components

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02471 vitamin B12/bleomycin/antimicrobial peptide transport system ATP-binding/permease protein ABC transporters -

Protein Sequence

MTKHSMNSKSELNKNKFIKQVWSLACPYWKSREWKIAWPLIISVIALNYIVVEIAVKYSDWNRDFFNLMQNKDWDNFWPMLSQFVLIMVVYSSVDLIEEYLRRTLRIRWRGWLTEWFLTQWLSHKRIYRHQLLYKESDNPDQRIAQDIKEFCDQTLQLGLGLLRTITSLVSFTVILWNLSGTLTFELGGMTWVIPGYMVWVAILYSVIGTWLTHKITRKLIPLTFQQEKCEADFRFHLMRVKEYAESISFLRGEKAELSSSKRLFGKIWQNWQYLTGMKMKYQAFNSGYNEVARIFPYLVASPRLMSGSLQLGDMMQTATGFYRVQEAFSWFVDSYESVANWRAVTGRLVTFSSQLDSITGTGTIRQSDSPEWSELSVFLPDNRPVQENMSGAFPDSSSITGPSGCGKSTFLRTLAGLWPHYKGSLSMPPDNNCMFIPQKPYLPEATLREILIYPHIHGEYDDALLAGALTDVGLSHFIPELDTGKNWQHTLSGGELQKIMLARCLIQKPAWLFLDEALSALDEENYKTLSRLLREKLAHSHIIEISHREDVRNDKPGLIL

Flanking regions ( +/- flanking 50bp)

TTGAGACATAAGAAACTGCCGGCGGAAATTCTGTTTTCTGCCGGCAGCCCATGACAAAACACAGTATGAATAGTAAATCTGAATTAAATAAAAATAAATTTATCAAACAGGTCTGGAGCCTGGCCTGTCCATATTGGAAAAGCCGGGAATGGAAAATAGCCTGGCCGCTGATTATTTCTGTTATTGCACTTAATTATATTGTTGTTGAAATTGCAGTGAAATACAGCGACTGGAACCGTGATTTTTTTAATCTTATGCAGAATAAGGACTGGGATAATTTCTGGCCGATGCTGAGTCAGTTTGTTCTGATCATGGTGGTTTATTCTTCTGTCGATCTTATTGAAGAATATTTGCGCCGGACATTACGTATCCGCTGGCGGGGCTGGCTGACAGAGTGGTTTCTTACGCAGTGGCTGAGCCATAAGCGTATTTACCGGCATCAGCTTTTATACAAAGAGAGTGATAATCCGGATCAGCGTATTGCTCAGGATATAAAAGAATTTTGCGATCAGACATTGCAGCTGGGACTGGGATTACTGCGGACTATCACCAGTCTGGTGTCTTTTACCGTTATTTTATGGAATCTTTCCGGAACACTGACATTTGAACTGGGCGGAATGACATGGGTAATACCGGGATATATGGTATGGGTGGCAATATTGTATTCCGTTATCGGTACATGGCTCACCCATAAAATTACCAGAAAACTGATCCCGCTGACATTTCAGCAGGAAAAATGTGAAGCCGATTTTCGTTTTCATCTGATGCGGGTAAAAGAATACGCGGAATCGATCAGTTTTCTGCGCGGTGAAAAGGCGGAATTATCCTCATCAAAACGGTTATTCGGGAAAATATGGCAGAACTGGCAATATCTGACCGGAATGAAAATGAAATATCAGGCCTTTAACAGCGGATATAATGAGGTTGCCCGCATTTTCCCGTATCTGGTGGCATCGCCGCGGCTGATGAGCGGCAGTCTGCAACTCGGGGATATGATGCAGACCGCAACCGGATTTTACCGGGTACAGGAAGCATTCAGCTGGTTTGTCGATTCTTATGAGTCAGTAGCAAACTGGCGGGCAGTCACCGGGCGTCTGGTGACATTCAGTTCGCAGCTGGATTCTATTACCGGCACCGGCACAATCCGTCAGTCTGATTCTCCCGAATGGTCTGAGTTATCAGTATTTTTACCGGATAACCGCCCGGTTCAGGAAAATATGTCCGGTGCCTTTCCGGACAGCAGCTCAATAACAGGCCCGTCGGGATGCGGGAAAAGTACATTCCTGCGCACACTCGCCGGATTATGGCCGCATTATAAAGGTTCATTATCCATGCCTCCGGATAATAACTGCATGTTTATTCCCCAGAAACCGTATTTACCGGAAGCCACATTGCGGGAAATTTTAATATATCCCCATATTCACGGGGAATATGACGATGCATTGCTGGCCGGTGCATTAACGGATGTGGGACTCAGTCATTTTATTCCTGAACTGGATACCGGGAAAAACTGGCAGCACACATTATCCGGCGGAGAACTTCAGAAAATAATGCTGGCGCGGTGTCTGATACAAAAACCGGCCTGGCTGTTTCTCGATGAGGCCTTATCCGCACTCGATGAGGAAAATTATAAAACACTGAGCCGGTTACTCAGGGAAAAACTGGCTCACAGTCATATTATCGAAATATCTCACAGGGAAGACGTGAGAAATGATAAGCCCGGGTTGATTTTATGAAAAGAATACTACTGATAACCGGCATGTTATTTATTTTGTCCGCCTGTTCC