Homologs in group_629

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_01395 FBDBKF_01395 100.0 Morganella morganii S1 acpS Phosphopantetheinyl transferase (holo-ACP synthase)
EHELCC_00150 EHELCC_00150 100.0 Morganella morganii S2 acpS Phosphopantetheinyl transferase (holo-ACP synthase)
NLDBIP_03310 NLDBIP_03310 100.0 Morganella morganii S4 acpS Phosphopantetheinyl transferase (holo-ACP synthase)
LHKJJB_04825 LHKJJB_04825 100.0 Morganella morganii S3 acpS Phosphopantetheinyl transferase (holo-ACP synthase)
F4V73_RS02000 F4V73_RS02000 94.5 Morganella psychrotolerans acpS holo-ACP synthase
PMI_RS09300 PMI_RS09300 71.4 Proteus mirabilis HI4320 acpS holo-ACP synthase

Distribution of the homologs in the orthogroup group_629

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_629

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
A9N1T5 1.59e-62 189 72 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B2VEA7 5.66e-62 188 71 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A9MGY0 6.22e-62 188 71 0 127 3 acpS Holo-[acyl-carrier-protein] synthase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A6TCH7 1.05e-61 187 71 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
P63466 1.1e-61 187 71 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P63467 1.1e-61 187 71 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Salmonella typhi
B4TS10 1.1e-61 187 71 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Salmonella schwarzengrund (strain CVM19633)
B5BAT4 1.1e-61 187 71 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Salmonella paratyphi A (strain AKU_12601)
Q5PIJ4 1.1e-61 187 71 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4TE11 1.1e-61 187 71 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Salmonella heidelberg (strain SL476)
B5RD45 1.1e-61 187 71 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QTU4 1.1e-61 187 71 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Salmonella enteritidis PT4 (strain P125109)
B5FRC1 1.1e-61 187 71 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Salmonella dublin (strain CT_02021853)
B5F1F7 1.1e-61 187 71 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Salmonella agona (strain SL483)
C0PYH1 1.69e-61 187 71 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Salmonella paratyphi C (strain RKS4594)
Q57LD4 1.69e-61 187 71 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Salmonella choleraesuis (strain SC-B67)
A8AD21 2.4e-61 187 70 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
C6DBM7 2.8e-61 186 71 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
B4T1F4 3.03e-61 186 71 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Salmonella newport (strain SL254)
B1IVR4 3.16e-61 186 70 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P24224 3.57e-61 186 70 0 126 1 acpS Holo-[acyl-carrier-protein] synthase Escherichia coli (strain K12)
C4ZYI6 3.57e-61 186 70 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Escherichia coli (strain K12 / MC4100 / BW2952)
Q1R8H0 3.98e-61 186 69 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Escherichia coli (strain UTI89 / UPEC)
Q8FF19 3.98e-61 186 69 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TES5 3.98e-61 186 69 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AE93 3.98e-61 186 69 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Escherichia coli O1:K1 / APEC
B7MYJ4 3.98e-61 186 69 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Escherichia coli O81 (strain ED1a)
B7MIP8 3.98e-61 186 69 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UH03 3.98e-61 186 69 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q32CV8 4.69e-61 186 69 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Shigella dysenteriae serotype 1 (strain Sd197)
A8A373 4.69e-61 186 69 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Escherichia coli O9:H4 (strain HS)
Q8XA39 4.69e-61 186 69 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Escherichia coli O157:H7
B5XNH4 4.96e-61 186 71 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Klebsiella pneumoniae (strain 342)
Q6D222 6.11e-61 186 71 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
B7LV01 9.89e-61 185 69 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
A8GI21 1.14e-60 185 69 0 125 3 acpS Holo-[acyl-carrier-protein] synthase Serratia proteamaculans (strain 568)
A4WDD4 1.19e-60 185 70 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Enterobacter sp. (strain 638)
Q3YYV3 1.52e-60 184 69 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Shigella sonnei (strain Ss046)
Q83K24 1.52e-60 184 69 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Shigella flexneri
Q0T1U2 1.52e-60 184 69 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Shigella flexneri serotype 5b (strain 8401)
Q31XS4 1.52e-60 184 69 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Shigella boydii serotype 4 (strain Sb227)
B2TXX6 1.52e-60 184 69 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B6I5D7 1.52e-60 184 69 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Escherichia coli (strain SE11)
B7M8H6 1.52e-60 184 69 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Escherichia coli O8 (strain IAI1)
B7NRL6 1.52e-60 184 69 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7LDF6 1.52e-60 184 69 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Escherichia coli (strain 55989 / EAEC)
A7ZQ07 1.52e-60 184 69 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Escherichia coli O139:H28 (strain E24377A / ETEC)
A7MH03 1.97e-60 184 72 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Cronobacter sakazakii (strain ATCC BAA-894)
B1LP76 4.2e-60 183 69 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Escherichia coli (strain SMS-3-5 / SECEC)
B7N6F1 4.2e-60 183 69 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
A1JKK7 1.57e-59 182 69 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B1JRD1 9.46e-59 180 69 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q667V4 9.46e-59 180 69 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Yersinia pseudotuberculosis serotype I (strain IP32953)
B2KA43 9.46e-59 180 69 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A7FFU3 9.46e-59 180 69 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A4TKX4 2.45e-58 179 68 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Yersinia pestis (strain Pestoides F)
Q1CKE0 2.45e-58 179 68 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Yersinia pestis bv. Antiqua (strain Nepal516)
A9R406 2.45e-58 179 68 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Yersinia pestis bv. Antiqua (strain Angola)
Q8ZCP5 2.45e-58 179 68 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Yersinia pestis
Q1C5D9 2.45e-58 179 68 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Yersinia pestis bv. Antiqua (strain Antiqua)
Q2NS17 8.56e-58 177 72 0 125 3 acpS Holo-[acyl-carrier-protein] synthase Sodalis glossinidius (strain morsitans)
C5B8X8 1.84e-56 174 68 0 125 3 acpS Holo-[acyl-carrier-protein] synthase Edwardsiella ictaluri (strain 93-146)
Q7N1X9 3.67e-56 174 70 0 125 3 acpS Holo-[acyl-carrier-protein] synthase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A5F5H4 7.38e-49 155 60 0 123 3 acpS Holo-[acyl-carrier-protein] synthase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q87LP3 1.08e-48 155 61 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B5FAG6 2.26e-48 154 59 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Aliivibrio fischeri (strain MJ11)
C3LR00 4.08e-48 153 60 0 123 3 acpS Holo-[acyl-carrier-protein] synthase Vibrio cholerae serotype O1 (strain M66-2)
Q9KPB6 4.08e-48 153 60 0 123 1 acpS Holo-[acyl-carrier-protein] synthase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q5E318 5.19e-48 153 59 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Aliivibrio fischeri (strain ATCC 700601 / ES114)
B6EKM5 1.42e-47 152 60 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Aliivibrio salmonicida (strain LFI1238)
A7MZA4 1.75e-47 152 61 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Vibrio campbellii (strain ATCC BAA-1116)
B7VK75 7.23e-46 147 57 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Vibrio atlanticus (strain LGP32)
Q8K9R3 8.15e-46 147 56 0 125 3 acpS Holo-[acyl-carrier-protein] synthase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q6LMS5 1.3e-44 144 57 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Photobacterium profundum (strain SS9)
Q8DC72 1.62e-44 144 58 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Vibrio vulnificus (strain CMCP6)
Q7MHP2 2.95e-44 143 58 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Vibrio vulnificus (strain YJ016)
Q1LTI6 4.94e-44 144 58 0 125 3 acpS Holo-[acyl-carrier-protein] synthase Baumannia cicadellinicola subsp. Homalodisca coagulata
Q492D3 1.44e-42 139 53 0 123 3 acpS Holo-[acyl-carrier-protein] synthase Blochmanniella pennsylvanica (strain BPEN)
Q7VRR2 4.57e-41 135 52 0 124 3 acpS Holo-[acyl-carrier-protein] synthase Blochmanniella floridana
B4RXM9 5.48e-41 135 55 2 129 3 acpS Holo-[acyl-carrier-protein] synthase Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
Q8D303 9.84e-39 130 51 1 132 3 acpS Holo-[acyl-carrier-protein] synthase Wigglesworthia glossinidia brevipalpis
C4K8H4 4.18e-38 128 58 0 125 3 acpS Holo-[acyl-carrier-protein] synthase Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
Q15PH8 2.65e-37 126 50 1 126 3 acpS Holo-[acyl-carrier-protein] synthase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
B8D7F3 1.76e-36 124 49 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57344 1.76e-36 124 49 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D949 1.76e-36 124 49 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
Q2Y864 3.7e-36 123 49 0 123 3 acpS Holo-[acyl-carrier-protein] synthase Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
P59475 2.13e-34 119 48 2 127 3 acpS Holo-[acyl-carrier-protein] synthase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
A0KZM8 3.24e-34 118 56 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Shewanella sp. (strain ANA-3)
Q31HN9 8.46e-34 117 46 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q0HGA2 1.27e-33 116 55 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Shewanella sp. (strain MR-4)
Q0HSJ5 7.03e-33 115 54 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Shewanella sp. (strain MR-7)
Q820I1 8.53e-33 114 47 0 123 3 acpS Holo-[acyl-carrier-protein] synthase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q8EH77 2.97e-32 113 53 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q5R110 7.21e-32 112 46 1 127 3 acpS Holo-[acyl-carrier-protein] synthase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
A6WKR1 1.38e-31 111 52 0 127 3 acpS Holo-[acyl-carrier-protein] synthase Shewanella baltica (strain OS185)
B8EBP8 1.58e-31 111 53 2 129 3 acpS Holo-[acyl-carrier-protein] synthase Shewanella baltica (strain OS223)
A1RMC3 1.92e-31 111 54 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Shewanella sp. (strain W3-18-1)
A1S3Y5 3.23e-31 110 47 0 124 3 acpS Holo-[acyl-carrier-protein] synthase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
A3D1W0 3.45e-31 110 52 2 129 3 acpS Holo-[acyl-carrier-protein] synthase Shewanella baltica (strain OS155 / ATCC BAA-1091)
A4Y4K8 8.63e-31 109 53 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A9L5P0 1.85e-30 108 51 2 129 3 acpS Holo-[acyl-carrier-protein] synthase Shewanella baltica (strain OS195)
Q0AF73 2.59e-30 108 45 0 123 3 acpS Holo-[acyl-carrier-protein] synthase Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
B1KI61 6.08e-30 107 51 1 131 3 acpS Holo-[acyl-carrier-protein] synthase Shewanella woodyi (strain ATCC 51908 / MS32)
Q07Z00 1.06e-29 107 54 2 128 3 acpS Holo-[acyl-carrier-protein] synthase Shewanella frigidimarina (strain NCIMB 400)
A8FSE0 1.11e-29 107 51 1 131 3 acpS Holo-[acyl-carrier-protein] synthase Shewanella sediminis (strain HAW-EB3)
A3QBT1 9.42e-29 104 51 1 132 3 acpS Holo-[acyl-carrier-protein] synthase Shewanella loihica (strain ATCC BAA-1088 / PV-4)
B0TIW1 1.62e-28 103 53 1 130 3 acpS Holo-[acyl-carrier-protein] synthase Shewanella halifaxensis (strain HAW-EB4)
A8H1D1 5.92e-28 102 51 1 130 3 acpS Holo-[acyl-carrier-protein] synthase Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B8CQJ1 1.19e-27 101 52 1 130 3 acpS Holo-[acyl-carrier-protein] synthase Shewanella piezotolerans (strain WP3 / JCM 13877)
Q12KI5 6.44e-27 99 53 0 126 3 acpS Holo-[acyl-carrier-protein] synthase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
A6VUP9 1.45e-26 99 47 3 130 3 acpS Holo-[acyl-carrier-protein] synthase Marinomonas sp. (strain MWYL1)
Q21XM1 5.56e-26 97 41 2 129 3 acpS Holo-[acyl-carrier-protein] synthase Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
C5CSF9 6.48e-26 97 42 2 128 3 acpS Holo-[acyl-carrier-protein] synthase Variovorax paradoxus (strain S110)
A1K608 7.25e-26 97 44 1 124 3 acpS Holo-[acyl-carrier-protein] synthase Azoarcus sp. (strain BH72)
A1VCV8 7.53e-26 97 50 2 125 3 acpS Holo-[acyl-carrier-protein] synthase Nitratidesulfovibrio vulgaris (strain DP4)
A1VRS8 9.38e-26 97 41 2 128 3 acpS Holo-[acyl-carrier-protein] synthase Polaromonas naphthalenivorans (strain CJ2)
Q72AT2 1.04e-25 96 50 2 125 3 acpS Holo-[acyl-carrier-protein] synthase Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
B8IZX1 1.34e-25 96 47 1 123 3 acpS Holo-[acyl-carrier-protein] synthase Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)
B2JFK6 1.7e-25 96 41 2 131 3 acpS Holo-[acyl-carrier-protein] synthase Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q68WF9 2.75e-25 95 41 3 128 3 acpS Holo-[acyl-carrier-protein] synthase Rickettsia typhi (strain ATCC VR-144 / Wilmington)
A1WT13 4.58e-25 95 49 0 125 3 acpS Holo-[acyl-carrier-protein] synthase Halorhodospira halophila (strain DSM 244 / SL1)
A6SXR7 6.78e-25 94 45 2 130 3 acpS Holo-[acyl-carrier-protein] synthase Janthinobacterium sp. (strain Marseille)
Q126K7 1.13e-24 94 39 3 130 3 acpS Holo-[acyl-carrier-protein] synthase Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q0BH00 1.44e-24 94 40 2 132 3 acpS Holo-[acyl-carrier-protein] synthase Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
A4G6R4 1.62e-24 94 43 2 130 3 acpS Holo-[acyl-carrier-protein] synthase Herminiimonas arsenicoxydans
B1XZM3 1.86e-24 93 40 2 130 3 acpS Holo-[acyl-carrier-protein] synthase Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
B1YVM8 2.09e-24 94 40 2 132 3 acpS Holo-[acyl-carrier-protein] synthase Burkholderia ambifaria (strain MC40-6)
Q47EF3 2.13e-24 93 44 1 123 3 acpS Holo-[acyl-carrier-protein] synthase Dechloromonas aromatica (strain RCB)
Q28V25 2.29e-24 94 40 1 130 3 acpS Holo-[acyl-carrier-protein] synthase Jannaschia sp. (strain CCS1)
A4JCR5 3.17e-24 93 40 2 132 3 acpS Holo-[acyl-carrier-protein] synthase Burkholderia vietnamiensis (strain G4 / LMG 22486)
A7Z1L9 3.63e-24 92 44 3 125 3 acpS Holo-[acyl-carrier-protein] synthase Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
C1D7L8 4.14e-24 92 45 0 123 3 acpS Holo-[acyl-carrier-protein] synthase Laribacter hongkongensis (strain HLHK9)
A9ADD4 4.5e-24 93 40 2 132 3 acpS Holo-[acyl-carrier-protein] synthase Burkholderia multivorans (strain ATCC 17616 / 249)
A1WAW0 4.59e-24 92 38 2 130 3 acpS Holo-[acyl-carrier-protein] synthase Acidovorax sp. (strain JS42)
B9MDP1 4.59e-24 92 38 2 130 3 acpS Holo-[acyl-carrier-protein] synthase Acidovorax ebreus (strain TPSY)
Q1GDH3 7.69e-24 92 40 1 127 3 acpS Holo-[acyl-carrier-protein] synthase Ruegeria sp. (strain TM1040)
A1AZ41 9.21e-24 92 38 1 127 3 acpS Holo-[acyl-carrier-protein] synthase Paracoccus denitrificans (strain Pd 1222)
Q39I69 1.05e-23 92 40 2 132 3 acpS Holo-[acyl-carrier-protein] synthase Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
B3E694 1.5e-23 91 41 0 123 3 acpS Holo-[acyl-carrier-protein] synthase Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
B1JYB7 2.05e-23 91 39 2 132 3 acpS Holo-[acyl-carrier-protein] synthase Burkholderia orbicola (strain MC0-3)
Q1BXT7 2.19e-23 91 39 2 132 3 acpS Holo-[acyl-carrier-protein] synthase Burkholderia orbicola (strain AU 1054)
A0K5W3 2.19e-23 91 39 2 132 3 acpS Holo-[acyl-carrier-protein] synthase Burkholderia cenocepacia (strain HI2424)
B2SZV1 2.35e-23 91 41 2 131 3 acpS Holo-[acyl-carrier-protein] synthase Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
A2SDH7 3.2e-23 90 42 4 132 3 acpS Holo-[acyl-carrier-protein] synthase Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
A4WVP7 4.12e-23 90 40 2 127 3 acpS Holo-[acyl-carrier-protein] synthase Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
B1XTL7 5.81e-23 90 38 2 127 3 acpS Holo-[acyl-carrier-protein] synthase Polynucleobacter necessarius subsp. necessarius (strain STIR1)
A8Z4X4 1.28e-22 88 39 3 126 3 acpS Holo-[acyl-carrier-protein] synthase Staphylococcus aureus (strain USA300 / TCH1516)
A6QIR6 1.28e-22 88 39 3 126 3 acpS Holo-[acyl-carrier-protein] synthase Staphylococcus aureus (strain Newman)
Q5HED0 1.28e-22 88 39 3 126 1 acpS Holo-[acyl-carrier-protein] synthase Staphylococcus aureus (strain COL)
Q9ZAH6 1.28e-22 88 39 3 126 3 acpS Holo-[acyl-carrier-protein] synthase Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FF54 1.28e-22 88 39 3 126 3 acpS Holo-[acyl-carrier-protein] synthase Staphylococcus aureus (strain USA300)
Q5P082 1.58e-22 88 42 1 123 3 acpS Holo-[acyl-carrier-protein] synthase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q7NWB8 1.61e-22 88 47 0 124 3 acpS Holo-[acyl-carrier-protein] synthase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
A5CDM0 1.66e-22 88 38 2 130 3 acpS Holo-[acyl-carrier-protein] synthase Orientia tsutsugamushi (strain Boryong)
Q3JCY7 2.34e-22 89 50 0 122 3 acpS Holo-[acyl-carrier-protein] synthase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q1RHU1 3.05e-22 87 42 3 126 3 acpS Holo-[acyl-carrier-protein] synthase Rickettsia bellii (strain RML369-C)
A8GW65 3.05e-22 87 42 3 126 3 acpS Holo-[acyl-carrier-protein] synthase Rickettsia bellii (strain OSU 85-389)
Q9ZCX5 3.07e-22 87 39 3 128 3 acpS Holo-[acyl-carrier-protein] synthase Rickettsia prowazekii (strain Madrid E)
Q8Y0H7 3.43e-22 88 38 3 134 3 acpS Holo-[acyl-carrier-protein] synthase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
C4XGU1 3.8e-22 87 48 1 123 3 acpS Holo-[acyl-carrier-protein] synthase Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
A8LLD7 3.92e-22 87 38 1 126 3 acpS Holo-[acyl-carrier-protein] synthase Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
Q3J5W3 3.93e-22 87 39 2 127 3 acpS Holo-[acyl-carrier-protein] synthase Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
C4L132 4.5e-22 87 41 3 125 3 acpS Holo-[acyl-carrier-protein] synthase Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
A0L8S4 4.54e-22 87 39 3 130 3 acpS Holo-[acyl-carrier-protein] synthase Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
A4SVW6 5.05e-22 87 37 2 127 3 acpS Holo-[acyl-carrier-protein] synthase Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
Q5LNK3 6e-22 87 39 2 129 3 acpS Holo-[acyl-carrier-protein] synthase Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q0APC3 7.28e-22 87 40 1 127 3 acpS Holo-[acyl-carrier-protein] synthase Maricaulis maris (strain MCS10)
P63470 8.98e-22 86 38 3 126 3 acpS Holo-[acyl-carrier-protein] synthase Staphylococcus aureus (strain MW2)
Q6G7N8 8.98e-22 86 38 3 126 3 acpS Holo-[acyl-carrier-protein] synthase Staphylococcus aureus (strain MSSA476)
Q6GF02 8.98e-22 86 38 3 126 3 acpS Holo-[acyl-carrier-protein] synthase Staphylococcus aureus (strain MRSA252)
P63469 8.98e-22 86 38 3 126 3 acpS Holo-[acyl-carrier-protein] synthase Staphylococcus aureus (strain N315)
P63468 8.98e-22 86 38 3 126 3 acpS Holo-[acyl-carrier-protein] synthase Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q2YUI2 8.98e-22 86 38 3 126 3 acpS Holo-[acyl-carrier-protein] synthase Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5IUL7 8.98e-22 86 38 3 126 3 acpS Holo-[acyl-carrier-protein] synthase Staphylococcus aureus (strain JH9)
A6U3F7 8.98e-22 86 38 3 126 3 acpS Holo-[acyl-carrier-protein] synthase Staphylococcus aureus (strain JH1)
A7X4P8 8.98e-22 86 38 3 126 3 acpS Holo-[acyl-carrier-protein] synthase Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q16AI8 9.43e-22 87 40 2 127 3 acpS Holo-[acyl-carrier-protein] synthase Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q4L7V6 9.79e-22 86 38 2 126 3 acpS Holo-[acyl-carrier-protein] synthase Staphylococcus haemolyticus (strain JCSC1435)
Q0A8Y7 1.1e-21 86 47 1 126 3 acpS Holo-[acyl-carrier-protein] synthase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
B9KSA5 1.16e-21 86 38 2 127 3 acpS Holo-[acyl-carrier-protein] synthase Cereibacter sphaeroides (strain KD131 / KCTC 12085)
A3PGF6 1.16e-21 86 38 2 127 3 acpS Holo-[acyl-carrier-protein] synthase Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
Q6MAG4 1.6e-21 85 40 3 124 3 acpS Holo-[acyl-carrier-protein] synthase Protochlamydia amoebophila (strain UWE25)
Q2SXT0 1.79e-21 86 39 2 130 3 acpS Holo-[acyl-carrier-protein] synthase Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
B3CQ27 1.82e-21 85 40 1 120 3 acpS Holo-[acyl-carrier-protein] synthase Orientia tsutsugamushi (strain Ikeda)
Q8KB56 1.99e-21 85 43 2 120 3 acpS Holo-[acyl-carrier-protein] synthase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q63S99 2.11e-21 86 40 4 133 3 acpS Holo-[acyl-carrier-protein] synthase Burkholderia pseudomallei (strain K96243)
A1V6B3 2.11e-21 86 40 4 133 3 acpS Holo-[acyl-carrier-protein] synthase Burkholderia mallei (strain SAVP1)
Q62LS6 2.11e-21 86 40 4 133 3 acpS Holo-[acyl-carrier-protein] synthase Burkholderia mallei (strain ATCC 23344)
A2S9Z9 2.11e-21 86 40 4 133 3 acpS Holo-[acyl-carrier-protein] synthase Burkholderia mallei (strain NCTC 10229)
A3MM38 2.11e-21 86 40 4 133 3 acpS Holo-[acyl-carrier-protein] synthase Burkholderia mallei (strain NCTC 10247)
A3NXL2 2.23e-21 86 40 4 133 3 acpS Holo-[acyl-carrier-protein] synthase Burkholderia pseudomallei (strain 1106a)
A3NBS5 2.8e-21 85 40 4 133 3 acpS Holo-[acyl-carrier-protein] synthase Burkholderia pseudomallei (strain 668)
B4RCU9 2.9e-21 85 39 2 129 3 acpS Holo-[acyl-carrier-protein] synthase Phenylobacterium zucineum (strain HLK1)
A9W511 2.93e-21 85 40 1 127 3 acpS Holo-[acyl-carrier-protein] synthase Methylorubrum extorquens (strain PA1)
Q2LTJ7 3.56e-21 85 39 0 121 3 acpS Holo-[acyl-carrier-protein] synthase Syntrophus aciditrophicus (strain SB)
B7L2A4 3.68e-21 85 41 3 129 3 acpS Holo-[acyl-carrier-protein] synthase Methylorubrum extorquens (strain CM4 / NCIMB 13688)
Q136W1 4.15e-21 85 42 3 130 3 acpS Holo-[acyl-carrier-protein] synthase Rhodopseudomonas palustris (strain BisB5)
Q8CNK6 4.2e-21 84 39 3 128 3 acpS Holo-[acyl-carrier-protein] synthase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HME4 4.2e-21 84 39 3 128 3 acpS Holo-[acyl-carrier-protein] synthase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q4FLS7 4.23e-21 85 39 2 128 3 acpS Holo-[acyl-carrier-protein] synthase Pelagibacter ubique (strain HTCC1062)
A8GP44 4.78e-21 84 38 2 128 3 acpS Holo-[acyl-carrier-protein] synthase Rickettsia akari (strain Hartford)
A8GSU8 5.16e-21 84 39 3 128 3 acpS Holo-[acyl-carrier-protein] synthase Rickettsia rickettsii (strain Sheila Smith)
P96618 5.26e-21 84 44 4 125 1 acpS Holo-[acyl-carrier-protein] synthase Bacillus subtilis (strain 168)
B9M2U0 5.48e-21 84 36 0 123 3 acpS Holo-[acyl-carrier-protein] synthase Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
Q46Z22 6.09e-21 85 39 2 128 3 acpS Holo-[acyl-carrier-protein] synthase Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
C5D4D1 6.55e-21 84 41 4 125 3 acpS Holo-[acyl-carrier-protein] synthase Geobacillus sp. (strain WCH70)
A9BNJ1 7.37e-21 84 36 2 128 3 acpS Holo-[acyl-carrier-protein] synthase Delftia acidovorans (strain DSM 14801 / SPH-1)
Q7VWV9 9.19e-21 84 41 3 131 3 acpS Holo-[acyl-carrier-protein] synthase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q2IWU7 1.06e-20 84 41 3 130 3 acpS Holo-[acyl-carrier-protein] synthase Rhodopseudomonas palustris (strain HaA2)
Q7WH64 1.26e-20 84 41 3 131 3 acpS Holo-[acyl-carrier-protein] synthase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
C6BV78 1.9e-20 83 43 1 123 3 acpS Holo-[acyl-carrier-protein] synthase Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
B9JC71 1.94e-20 83 41 2 127 3 acpS Holo-[acyl-carrier-protein] synthase Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
A5CWJ8 1.94e-20 83 34 0 123 3 acpS Holo-[acyl-carrier-protein] synthase Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
A8F257 1.98e-20 83 37 4 130 3 acpS Holo-[acyl-carrier-protein] synthase Rickettsia massiliae (strain Mtu5)
Q5L3G7 1.98e-20 83 43 4 126 3 acpS Holo-[acyl-carrier-protein] synthase Geobacillus kaustophilus (strain HTA426)
B0BYC4 2.04e-20 83 38 3 128 3 acpS Holo-[acyl-carrier-protein] synthase Rickettsia rickettsii (strain Iowa)
C4K1J2 2.04e-20 83 38 3 128 3 acpS Holo-[acyl-carrier-protein] synthase Rickettsia peacockii (strain Rustic)
A9IRM3 2.1e-20 83 40 1 127 3 acpS Holo-[acyl-carrier-protein] synthase Bartonella tribocorum (strain CIP 105476 / IBS 506)
A5FVX4 2.13e-20 83 39 2 128 3 acpS Holo-[acyl-carrier-protein] synthase Acidiphilium cryptum (strain JF-5)
A4SCZ9 2.19e-20 83 39 1 123 3 acpS Holo-[acyl-carrier-protein] synthase Chlorobium phaeovibrioides (strain DSM 265 / 1930)
B1Z872 2.27e-20 83 42 4 129 3 acpS Holo-[acyl-carrier-protein] synthase Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
Q92H90 2.3e-20 83 37 2 127 3 acpS Holo-[acyl-carrier-protein] synthase Rickettsia conorii (strain ATCC VR-613 / Malish 7)
A4IJT3 2.57e-20 83 43 4 126 3 acpS Holo-[acyl-carrier-protein] synthase Geobacillus thermodenitrificans (strain NG80-2)
C3PP12 2.98e-20 82 37 2 127 3 acpS Holo-[acyl-carrier-protein] synthase Rickettsia africae (strain ESF-5)
Q7W9J6 3.78e-20 83 41 3 131 3 acpS Holo-[acyl-carrier-protein] synthase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
B7GIY1 4.16e-20 82 40 3 125 3 acpS Holo-[acyl-carrier-protein] synthase Anoxybacillus flavithermus (strain DSM 21510 / WK1)
Q39UG1 4.18e-20 82 38 0 123 3 acpS Holo-[acyl-carrier-protein] synthase Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
B0T3H7 4.89e-20 82 40 3 129 3 acpS Holo-[acyl-carrier-protein] synthase Caulobacter sp. (strain K31)
Q8UGK4 4.91e-20 82 40 2 127 3 acpS Holo-[acyl-carrier-protein] synthase Agrobacterium fabrum (strain C58 / ATCC 33970)
B8IMY6 5.98e-20 82 38 2 127 3 acpS Holo-[acyl-carrier-protein] synthase Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
Q4UKX9 6.64e-20 82 36 2 127 3 acpS Holo-[acyl-carrier-protein] synthase Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
C3M8S2 6.99e-20 82 40 2 127 3 acpS Holo-[acyl-carrier-protein] synthase Sinorhizobium fredii (strain NBRC 101917 / NGR234)
B3QR46 7.13e-20 81 41 2 121 3 acpS Holo-[acyl-carrier-protein] synthase Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
A7GKE4 7.19e-20 81 43 6 128 3 acpS Holo-[acyl-carrier-protein] synthase Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
A4J8G9 7.22e-20 81 45 3 117 3 acpS Holo-[acyl-carrier-protein] synthase Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
P63465 8.25e-20 82 39 1 127 3 acpS Holo-[acyl-carrier-protein] synthase Brucella suis biovar 1 (strain 1330)
B0CKY5 8.25e-20 82 39 1 127 3 acpS Holo-[acyl-carrier-protein] synthase Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VPJ6 8.25e-20 82 39 1 127 3 acpS Holo-[acyl-carrier-protein] synthase Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
P63464 8.25e-20 82 39 1 127 3 acpS Holo-[acyl-carrier-protein] synthase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RI01 8.25e-20 82 39 1 127 3 acpS Holo-[acyl-carrier-protein] synthase Brucella melitensis biotype 2 (strain ATCC 23457)
A9MA33 8.25e-20 82 39 1 127 3 acpS Holo-[acyl-carrier-protein] synthase Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q57E83 8.25e-20 82 39 1 127 3 acpS Holo-[acyl-carrier-protein] synthase Brucella abortus biovar 1 (strain 9-941)
Q2YN04 8.25e-20 82 39 1 127 3 acpS Holo-[acyl-carrier-protein] synthase Brucella abortus (strain 2308)
B2SAD7 8.25e-20 82 39 1 127 3 acpS Holo-[acyl-carrier-protein] synthase Brucella abortus (strain S19)
Q1LKN5 1.02e-19 82 38 2 128 3 acpS Holo-[acyl-carrier-protein] synthase Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
B1LTR5 1.08e-19 81 39 1 127 3 acpS Holo-[acyl-carrier-protein] synthase Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
Q92R49 1.1e-19 81 40 2 127 3 acpS Holo-[acyl-carrier-protein] synthase Rhizobium meliloti (strain 1021)
B8D0V9 1.11e-19 81 38 1 123 3 acpS Holo-[acyl-carrier-protein] synthase Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562)
A5EKL9 1.2e-19 81 41 2 130 3 acpS Holo-[acyl-carrier-protein] synthase Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
A6U7A6 1.25e-19 81 40 2 127 3 acpS Holo-[acyl-carrier-protein] synthase Sinorhizobium medicae (strain WSM419)
Q6G461 1.27e-19 81 37 1 127 3 acpS Holo-[acyl-carrier-protein] synthase Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q49Z25 1.29e-19 80 38 3 126 3 acpS Holo-[acyl-carrier-protein] synthase Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
B3R1Z5 1.33e-19 81 39 2 128 3 acpS Holo-[acyl-carrier-protein] synthase Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q01RT7 1.65e-19 80 40 0 124 3 acpS Holo-[acyl-carrier-protein] synthase Solibacter usitatus (strain Ellin6076)
B8EK15 2.01e-19 81 40 2 129 3 acpS Holo-[acyl-carrier-protein] synthase Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
B9J0N5 2.04e-19 80 40 5 129 3 acpS Holo-[acyl-carrier-protein] synthase Bacillus cereus (strain Q1)
B7HRY9 2.04e-19 80 40 5 129 3 acpS Holo-[acyl-carrier-protein] synthase Bacillus cereus (strain AH187)
Q73ET8 2.04e-19 80 40 5 129 3 acpS Holo-[acyl-carrier-protein] synthase Bacillus cereus (strain ATCC 10987 / NRS 248)
A8EYA8 2.09e-19 80 38 2 125 3 acpS Holo-[acyl-carrier-protein] synthase Rickettsia canadensis (strain McKiel)
B9DMJ0 2.2e-19 80 38 3 126 3 acpS Holo-[acyl-carrier-protein] synthase Staphylococcus carnosus (strain TM300)
A0PY92 2.6e-19 80 39 2 126 3 acpS Holo-[acyl-carrier-protein] synthase Clostridium novyi (strain NT)
B8H624 2.76e-19 80 39 3 129 3 acpS Holo-[acyl-carrier-protein] synthase Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A807 2.76e-19 80 39 3 129 3 acpS Holo-[acyl-carrier-protein] synthase Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q6G084 2.91e-19 80 38 2 127 3 acpS Holo-[acyl-carrier-protein] synthase Bartonella quintana (strain Toulouse)
B5EI15 2.92e-19 80 38 0 123 3 acpS Holo-[acyl-carrier-protein] synthase Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
Q1GT99 3.04e-19 80 37 3 130 3 acpS Holo-[acyl-carrier-protein] synthase Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
B0SM94 3.21e-19 80 36 0 122 3 acpS Holo-[acyl-carrier-protein] synthase Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris)
B0SE17 3.21e-19 80 36 0 122 3 acpS Holo-[acyl-carrier-protein] synthase Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames)
Q11JT0 7.22e-19 79 38 1 127 3 acpS Holo-[acyl-carrier-protein] synthase Chelativorans sp. (strain BNC1)
Q9CH95 7.8e-19 79 38 3 128 3 acpS Holo-[acyl-carrier-protein] synthase Lactococcus lactis subsp. lactis (strain IL1403)
Q1IHY2 9e-19 79 43 0 123 3 acpS Holo-[acyl-carrier-protein] synthase Koribacter versatilis (strain Ellin345)
C6E2U2 9.5e-19 79 38 0 123 3 acpS Holo-[acyl-carrier-protein] synthase Geobacter sp. (strain M21)
Q057R6 9.96e-19 79 35 0 125 3 acpS Holo-[acyl-carrier-protein] synthase Buchnera aphidicola subsp. Cinara cedri (strain Cc)
Q6HPE3 1.14e-18 78 39 5 129 3 acpS Holo-[acyl-carrier-protein] synthase Bacillus thuringiensis subsp. konkukian (strain 97-27)
C1EU95 1.14e-18 78 39 5 129 3 acpS Holo-[acyl-carrier-protein] synthase Bacillus cereus (strain 03BB102)
B7JLE6 1.14e-18 78 39 5 129 3 acpS Holo-[acyl-carrier-protein] synthase Bacillus cereus (strain AH820)
Q81JG3 1.14e-18 78 39 5 129 1 acpS Holo-[acyl-carrier-protein] synthase Bacillus anthracis
A0R8U9 1.14e-18 78 39 5 129 3 acpS Holo-[acyl-carrier-protein] synthase Bacillus thuringiensis (strain Al Hakam)
C3LK79 1.14e-18 78 39 5 129 3 acpS Holo-[acyl-carrier-protein] synthase Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3PAT6 1.14e-18 78 39 5 129 3 acpS Holo-[acyl-carrier-protein] synthase Bacillus anthracis (strain A0248)
Q030B5 1.15e-18 78 37 3 128 3 acpS Holo-[acyl-carrier-protein] synthase Lactococcus lactis subsp. cremoris (strain SK11)
A2RLV5 1.15e-18 78 37 3 128 3 acpS Holo-[acyl-carrier-protein] synthase Lactococcus lactis subsp. cremoris (strain MG1363)
Q74C71 1.24e-18 78 36 0 123 3 acpS Holo-[acyl-carrier-protein] synthase Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
A1US34 1.31e-18 79 35 1 127 3 acpS Holo-[acyl-carrier-protein] synthase Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
B3QJH2 1.32e-18 79 38 2 130 3 acpS Holo-[acyl-carrier-protein] synthase Rhodopseudomonas palustris (strain TIE-1)
Q6N6C3 1.32e-18 79 38 2 130 3 acpS Holo-[acyl-carrier-protein] synthase Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q63GX2 1.43e-18 78 39 5 129 3 acpS Holo-[acyl-carrier-protein] synthase Bacillus cereus (strain ZK / E33L)
B5ZW71 1.58e-18 78 39 1 127 3 acpS Holo-[acyl-carrier-protein] synthase Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Q2KAE5 1.76e-18 78 39 1 127 3 acpS Holo-[acyl-carrier-protein] synthase Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q0K8N7 2.17e-18 78 38 3 130 3 acpS Holo-[acyl-carrier-protein] synthase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q97LR5 2.22e-18 77 37 2 124 3 acpS Holo-[acyl-carrier-protein] synthase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
C0R3N6 2.85e-18 77 36 3 125 3 acpS Holo-[acyl-carrier-protein] synthase Wolbachia sp. subsp. Drosophila simulans (strain wRi)
B2II98 3e-18 78 38 1 127 3 acpS Holo-[acyl-carrier-protein] synthase Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
O69159 3.13e-18 77 40 3 132 3 acpS Holo-[acyl-carrier-protein] synthase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q1MJ56 5.7e-18 77 39 1 127 3 acpS Holo-[acyl-carrier-protein] synthase Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q2GG91 5.93e-18 76 39 3 131 3 acpS Holo-[acyl-carrier-protein] synthase Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas)
B3PUN6 6.7e-18 77 37 1 127 3 acpS Holo-[acyl-carrier-protein] synthase Rhizobium etli (strain CIAT 652)
A7IM60 7.02e-18 77 39 1 126 3 acpS Holo-[acyl-carrier-protein] synthase Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
Q5FPZ9 7.52e-18 77 37 2 130 3 acpS Holo-[acyl-carrier-protein] synthase Gluconobacter oxydans (strain 621H)
Q2GK71 9.61e-18 76 39 3 127 3 acpS Holo-[acyl-carrier-protein] synthase Anaplasma phagocytophilum (strain HZ)
Q1QL52 1.01e-17 76 38 3 136 3 acpS Holo-[acyl-carrier-protein] synthase Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q3SKU1 1.12e-17 76 43 2 128 3 acpS Holo-[acyl-carrier-protein] synthase Thiobacillus denitrificans (strain ATCC 25259)
Q3SRB1 1.48e-17 76 38 3 132 3 acpS Holo-[acyl-carrier-protein] synthase Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q9KFG1 1.48e-17 75 40 5 125 3 acpS Holo-[acyl-carrier-protein] synthase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q0BTG4 2.23e-17 75 37 2 129 3 acpS Holo-[acyl-carrier-protein] synthase Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
Q3YSD5 2.24e-17 75 36 3 125 3 acpS Holo-[acyl-carrier-protein] synthase Ehrlichia canis (strain Jake)
Q73GW5 2.39e-17 75 36 3 125 3 acpS Holo-[acyl-carrier-protein] synthase Wolbachia pipientis wMel
B6JGF9 2.44e-17 75 46 2 97 3 acpS Holo-[acyl-carrier-protein] synthase Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
B4SFE8 2.47e-17 75 39 2 120 3 acpS Holo-[acyl-carrier-protein] synthase Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
Q74LB3 2.86e-17 75 34 3 125 3 acpS Holo-[acyl-carrier-protein] synthase Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
B3QTH9 2.95e-17 75 38 2 122 3 acpS Holo-[acyl-carrier-protein] synthase Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
Q3B672 3.4e-17 74 38 1 116 3 acpS Holo-[acyl-carrier-protein] synthase Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
Q04C46 3.44e-17 75 38 3 125 3 acpS Holo-[acyl-carrier-protein] synthase Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q1GBP7 3.44e-17 75 38 3 125 3 acpS Holo-[acyl-carrier-protein] synthase Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
Q2W515 3.61e-17 75 37 3 132 3 acpS Holo-[acyl-carrier-protein] synthase Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q985A8 4.05e-17 75 37 2 129 3 acpS Holo-[acyl-carrier-protein] synthase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q8F136 4.23e-17 74 35 0 121 3 acpS Holo-[acyl-carrier-protein] synthase Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72U18 4.23e-17 74 35 0 121 3 acpS Holo-[acyl-carrier-protein] synthase Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
B2S466 5.29e-17 74 41 4 124 3 acpS Holo-[acyl-carrier-protein] synthase Treponema pallidum subsp. pallidum (strain SS14)
O83800 5.29e-17 74 41 4 124 3 acpS Holo-[acyl-carrier-protein] synthase Treponema pallidum (strain Nichols)
Q07M73 5.62e-17 74 38 3 134 3 acpS Holo-[acyl-carrier-protein] synthase Rhodopseudomonas palustris (strain BisA53)
B3CL63 5.69e-17 74 36 4 125 3 acpS Holo-[acyl-carrier-protein] synthase Wolbachia pipientis subsp. Culex pipiens (strain wPip)
B4U177 5.76e-17 74 40 4 125 3 acpS Holo-[acyl-carrier-protein] synthase Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
Q0C3U0 5.96e-17 74 37 3 128 3 acpS Holo-[acyl-carrier-protein] synthase Hyphomonas neptunium (strain ATCC 15444)
Q214J8 6.39e-17 74 38 2 131 3 acpS Holo-[acyl-carrier-protein] synthase Rhodopseudomonas palustris (strain BisB18)
B9KIC8 6.39e-17 73 36 2 127 3 acpS Holo-[acyl-carrier-protein] synthase Anaplasma marginale (strain Florida)
Q5PAZ6 6.75e-17 73 36 2 127 3 acpS Holo-[acyl-carrier-protein] synthase Anaplasma marginale (strain St. Maries)
B1I1U5 7.69e-17 74 37 1 121 3 acpS Holo-[acyl-carrier-protein] synthase Desulforudis audaxviator (strain MP104C)
C0MEB8 8.14e-17 73 40 4 125 3 acpS Holo-[acyl-carrier-protein] synthase Streptococcus equi subsp. zooepidemicus (strain H70)
C0M6I4 8.14e-17 73 40 4 125 3 acpS Holo-[acyl-carrier-protein] synthase Streptococcus equi subsp. equi (strain 4047)
A9VQF0 8.72e-17 73 39 5 130 3 acpS Holo-[acyl-carrier-protein] synthase Bacillus mycoides (strain KBAB4)
Q8R857 9.85e-17 73 34 2 118 3 acpS Holo-[acyl-carrier-protein] synthase Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
B8DPF0 1.04e-16 73 47 1 123 3 acpS Holo-[acyl-carrier-protein] synthase Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
B8I3U1 1.09e-16 73 36 1 120 3 acpS Holo-[acyl-carrier-protein] synthase Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
B0UE20 1.18e-16 73 38 1 127 3 acpS Holo-[acyl-carrier-protein] synthase Methylobacterium sp. (strain 4-46)
B5YJG8 1.3e-16 73 33 2 122 3 acpS Holo-[acyl-carrier-protein] synthase Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
A1AWQ3 1.44e-16 73 39 2 125 3 acpS Holo-[acyl-carrier-protein] synthase Ruthia magnifica subsp. Calyptogena magnifica
B6IN03 2.71e-16 73 37 3 134 3 acpS Holo-[acyl-carrier-protein] synthase Rhodospirillum centenum (strain ATCC 51521 / SW)
Q2NCF7 4.29e-16 72 35 3 132 3 acpS Holo-[acyl-carrier-protein] synthase Erythrobacter litoralis (strain HTCC2594)
A9KLF9 5.11e-16 72 39 3 123 3 acpS Holo-[acyl-carrier-protein] synthase Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
C0ZK19 5.91e-16 72 38 3 126 3 acpS Holo-[acyl-carrier-protein] synthase Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
A8I3B0 6.02e-16 72 36 1 126 3 acpS Holo-[acyl-carrier-protein] synthase Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q88Z44 6.11e-16 71 42 2 90 1 acpS Holo-[acyl-carrier-protein] synthase Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q03DZ1 6.47e-16 71 34 3 125 3 acpS Holo-[acyl-carrier-protein] synthase Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
Q7NE72 6.58e-16 71 40 3 119 3 acpS Holo-[acyl-carrier-protein] synthase Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
B9E8C4 7.45e-16 71 40 4 125 3 acpS Holo-[acyl-carrier-protein] synthase Macrococcus caseolyticus (strain JCSC5402)
Q9PKT6 8.02e-16 71 39 3 127 3 acpS Holo-[acyl-carrier-protein] synthase Chlamydia muridarum (strain MoPn / Nigg)
Q30ZQ5 8.51e-16 71 45 1 123 3 acpS Holo-[acyl-carrier-protein] synthase Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q3AU14 9.76e-16 70 37 2 120 3 acpS Holo-[acyl-carrier-protein] synthase Chlorobium chlorochromatii (strain CaD3)
A5VD51 1e-15 71 37 3 132 3 acpS Holo-[acyl-carrier-protein] synthase Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
Q67K77 1.11e-15 70 37 2 124 3 acpS Holo-[acyl-carrier-protein] synthase Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q5NLS7 1.18e-15 71 39 3 129 3 acpS Holo-[acyl-carrier-protein] synthase Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q5FMB3 1.25e-15 70 33 3 125 3 acpS Holo-[acyl-carrier-protein] synthase Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q9Z8M5 1.5e-15 70 39 1 123 3 acpS Holo-[acyl-carrier-protein] synthase Chlamydia pneumoniae
Q8RDZ7 1.54e-15 70 35 3 123 3 acpS Holo-[acyl-carrier-protein] synthase Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
B3EGP9 1.71e-15 70 41 4 120 3 acpS Holo-[acyl-carrier-protein] synthase Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
A6M302 1.71e-15 70 38 3 123 3 acpS Holo-[acyl-carrier-protein] synthase Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
Q8XNP1 1.85e-15 70 34 3 127 3 acpS Holo-[acyl-carrier-protein] synthase Clostridium perfringens (strain 13 / Type A)
Q5GTK4 2.18e-15 70 42 2 91 3 acpS Holo-[acyl-carrier-protein] synthase Wolbachia sp. subsp. Brugia malayi (strain TRS)
Q8ESK9 2.56e-15 70 40 5 126 3 acpS Holo-[acyl-carrier-protein] synthase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q0SW89 2.82e-15 70 34 3 127 3 acpS Holo-[acyl-carrier-protein] synthase Clostridium perfringens (strain SM101 / Type A)
Q053N9 2.95e-15 70 35 1 121 3 acpS Holo-[acyl-carrier-protein] synthase Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04U76 2.95e-15 70 35 1 121 3 acpS Holo-[acyl-carrier-protein] synthase Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
Q0TUE3 4.72e-15 69 34 3 127 3 acpS Holo-[acyl-carrier-protein] synthase Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
B2TQY6 6.52e-15 68 37 4 126 3 acpS Holo-[acyl-carrier-protein] synthase Clostridium botulinum (strain Eklund 17B / Type B)
Q9RQW2 7.29e-15 68 37 0 123 3 acpS Holo-[acyl-carrier-protein] synthase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q48RM7 7.49e-15 68 40 4 125 3 acpS Holo-[acyl-carrier-protein] synthase Streptococcus pyogenes serotype M28 (strain MGAS6180)
A8YXI2 7.82e-15 68 32 3 125 3 acpS Holo-[acyl-carrier-protein] synthase Lactobacillus helveticus (strain DPC 4571)
B5EQL7 9.52e-15 68 36 3 130 3 acpS Holo-[acyl-carrier-protein] synthase Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J9K5 9.52e-15 68 36 3 130 3 acpS Holo-[acyl-carrier-protein] synthase Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
B2V003 1.06e-14 68 37 4 126 3 acpS Holo-[acyl-carrier-protein] synthase Clostridium botulinum (strain Alaska E43 / Type E3)
A1KVH5 1.07e-14 68 38 0 123 1 acpS Holo-[acyl-carrier-protein] synthase Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
P0A0Q6 1.07e-14 68 38 0 123 3 acpS Holo-[acyl-carrier-protein] synthase Neisseria meningitidis serogroup C
P0A0Q5 1.07e-14 68 38 0 123 3 acpS Holo-[acyl-carrier-protein] synthase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
A9M273 1.07e-14 68 38 0 123 3 acpS Holo-[acyl-carrier-protein] synthase Neisseria meningitidis serogroup C (strain 053442)
C1CSW0 1.18e-14 68 36 4 127 3 acpS Holo-[acyl-carrier-protein] synthase Streptococcus pneumoniae (strain Taiwan19F-14)
C1CM35 1.18e-14 68 36 4 127 3 acpS Holo-[acyl-carrier-protein] synthase Streptococcus pneumoniae (strain P1031)
C1CFR8 1.18e-14 68 36 4 127 3 acpS Holo-[acyl-carrier-protein] synthase Streptococcus pneumoniae (strain JJA)
P0A2W7 1.18e-14 68 36 4 127 1 acpS Holo-[acyl-carrier-protein] synthase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A2W6 1.18e-14 68 36 4 127 1 acpS Holo-[acyl-carrier-protein] synthase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
B8ZMG2 1.18e-14 68 36 4 127 3 acpS Holo-[acyl-carrier-protein] synthase Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
B1I756 1.18e-14 68 36 4 127 3 acpS Holo-[acyl-carrier-protein] synthase Streptococcus pneumoniae (strain Hungary19A-6)
C1C8T7 1.18e-14 68 36 4 127 3 acpS Holo-[acyl-carrier-protein] synthase Streptococcus pneumoniae (strain 70585)
B5E746 1.18e-14 68 36 4 127 3 acpS Holo-[acyl-carrier-protein] synthase Streptococcus pneumoniae serotype 19F (strain G54)
Q04J73 1.18e-14 68 36 4 127 3 acpS Holo-[acyl-carrier-protein] synthase Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
B4RQ92 1.36e-14 68 39 0 123 3 acpS Holo-[acyl-carrier-protein] synthase Neisseria gonorrhoeae (strain NCCP11945)
Q5F6P2 1.36e-14 68 39 0 123 3 acpS Holo-[acyl-carrier-protein] synthase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q3A5V3 1.46e-14 68 33 0 125 3 acpS Holo-[acyl-carrier-protein] synthase Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q99Y97 1.57e-14 67 39 4 125 3 acpS Holo-[acyl-carrier-protein] synthase Streptococcus pyogenes serotype M1
Q5HBI7 1.59e-14 68 36 3 129 3 acpS Holo-[acyl-carrier-protein] synthase Ehrlichia ruminantium (strain Welgevonden)
B1YF32 1.63e-14 68 38 5 125 3 acpS Holo-[acyl-carrier-protein] synthase Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
B2A4X6 1.8e-14 67 33 1 125 3 acpS Holo-[acyl-carrier-protein] synthase Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
B5XI22 1.93e-14 67 39 4 125 3 acpS Holo-[acyl-carrier-protein] synthase Streptococcus pyogenes serotype M49 (strain NZ131)
P0CZ51 1.93e-14 67 39 4 125 3 acpS Holo-[acyl-carrier-protein] synthase Streptococcus pyogenes serotype M3 (strain SSI-1)
A2RCT2 1.93e-14 67 39 4 125 3 acpS Holo-[acyl-carrier-protein] synthase Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J544 1.93e-14 67 39 4 125 3 acpS Holo-[acyl-carrier-protein] synthase Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JF93 1.93e-14 67 39 4 125 3 acpS Holo-[acyl-carrier-protein] synthase Streptococcus pyogenes serotype M2 (strain MGAS10270)
P63474 1.93e-14 67 39 4 125 3 acpS Holo-[acyl-carrier-protein] synthase Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5XAA3 1.93e-14 67 39 4 125 3 acpS Holo-[acyl-carrier-protein] synthase Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0CZ50 1.93e-14 67 39 4 125 3 acpS Holo-[acyl-carrier-protein] synthase Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q9FCV3 2.63e-14 67 36 3 125 3 acpS Holo-[acyl-carrier-protein] synthase Limosilactobacillus reuteri
Q38V63 3.68e-14 67 37 4 125 3 acpS Holo-[acyl-carrier-protein] synthase Latilactobacillus sakei subsp. sakei (strain 23K)
B9DVI4 4.29e-14 66 34 4 125 3 acpS Holo-[acyl-carrier-protein] synthase Streptococcus uberis (strain ATCC BAA-854 / 0140J)
B8DG74 4.47e-14 66 34 3 125 3 acpS Holo-[acyl-carrier-protein] synthase Listeria monocytogenes serotype 4a (strain HCC23)
Q1JK99 5.31e-14 66 39 4 125 3 acpS Holo-[acyl-carrier-protein] synthase Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JA49 5.31e-14 66 39 4 125 3 acpS Holo-[acyl-carrier-protein] synthase Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q7UQA5 5.39e-14 66 32 1 124 3 acpS Holo-[acyl-carrier-protein] synthase Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
B8G840 5.73e-14 67 35 2 128 3 acpS Holo-[acyl-carrier-protein] synthase Chloroflexus aggregans (strain MD-66 / DSM 9485)
Q73LF7 5.79e-14 66 36 4 125 3 acpS Holo-[acyl-carrier-protein] synthase Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q5FHL6 6.17e-14 66 35 3 129 3 acpS Holo-[acyl-carrier-protein] synthase Ehrlichia ruminantium (strain Gardel)
B9LIY4 7.39e-14 66 36 3 130 3 acpS Holo-[acyl-carrier-protein] synthase Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl)
A9WE63 7.39e-14 66 36 3 130 3 acpS Holo-[acyl-carrier-protein] synthase Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
A5US51 9.26e-14 66 35 2 127 3 acpS Holo-[acyl-carrier-protein] synthase Roseiflexus sp. (strain RS-1)
Q3Z9B0 1.02e-13 65 38 2 117 3 acpS Holo-[acyl-carrier-protein] synthase Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195)
P63472 1.83e-13 65 38 4 126 3 acpS Holo-[acyl-carrier-protein] synthase Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P63471 1.83e-13 65 38 4 126 3 acpS Holo-[acyl-carrier-protein] synthase Streptococcus agalactiae serotype III (strain NEM316)
Q3JZK4 1.83e-13 65 38 4 126 3 acpS Holo-[acyl-carrier-protein] synthase Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
A7HX46 2.96e-13 65 36 2 116 3 acpS Holo-[acyl-carrier-protein] synthase Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
A5N379 3.2e-13 65 35 2 125 3 acpS Holo-[acyl-carrier-protein] synthase Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
Q3ZZK3 3.42e-13 64 36 2 117 3 acpS Holo-[acyl-carrier-protein] synthase Dehalococcoides mccartyi (strain CBDB1)
A5FS12 3.42e-13 64 36 2 117 3 acpS Holo-[acyl-carrier-protein] synthase Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1)
A8FN84 3.62e-13 64 37 3 117 3 acpS Holo-[acyl-carrier-protein] synthase Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
Q8Y8L2 3.84e-13 64 33 3 125 3 acpS Holo-[acyl-carrier-protein] synthase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q721T0 3.84e-13 64 33 3 125 3 acpS Holo-[acyl-carrier-protein] synthase Listeria monocytogenes serotype 4b (strain F2365)
C1L1F5 3.84e-13 64 33 3 125 3 acpS Holo-[acyl-carrier-protein] synthase Listeria monocytogenes serotype 4b (strain CLIP80459)
Q5HT08 3.99e-13 64 37 3 117 3 acpS Holo-[acyl-carrier-protein] synthase Campylobacter jejuni (strain RM1221)
A1W123 3.99e-13 64 37 3 117 3 acpS Holo-[acyl-carrier-protein] synthase Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
A8FA63 4.35e-13 64 41 4 125 3 acpS Holo-[acyl-carrier-protein] synthase Bacillus pumilus (strain SAFR-032)
A7H5D0 4.79e-13 63 37 3 117 3 acpS Holo-[acyl-carrier-protein] synthase Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
A6Q7U5 4.98e-13 63 43 1 86 3 acpS Holo-[acyl-carrier-protein] synthase Sulfurovum sp. (strain NBC37-1)
Q03IX7 6.24e-13 63 35 4 127 3 acpS Holo-[acyl-carrier-protein] synthase Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q92DD0 7.97e-13 63 34 3 125 3 acpS Holo-[acyl-carrier-protein] synthase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
B7H4P0 8.16e-13 63 36 4 119 3 acpS Holo-[acyl-carrier-protein] synthase Bacillus cereus (strain B4264)
A0AH03 9.67e-13 63 33 3 125 3 acpS Holo-[acyl-carrier-protein] synthase Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
B9L9S0 9.69e-13 63 36 2 119 3 acpS Holo-[acyl-carrier-protein] synthase Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH)
Q1WV15 1.11e-12 63 36 4 129 3 acpS Holo-[acyl-carrier-protein] synthase Ligilactobacillus salivarius (strain UCC118)
Q9PMP8 1.25e-12 62 36 3 117 3 acpS Holo-[acyl-carrier-protein] synthase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q81IT7 1.35e-12 62 37 4 119 3 acpS Holo-[acyl-carrier-protein] synthase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B7IU30 1.35e-12 62 37 4 121 3 acpS Holo-[acyl-carrier-protein] synthase Bacillus cereus (strain G9842)
A1AR95 1.38e-12 63 36 1 125 3 acpS Holo-[acyl-carrier-protein] synthase Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
Q9WZF6 1.6e-12 63 37 6 129 1 acpS Holo-[acyl-carrier-protein] synthase Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
A4XIB7 1.96e-12 62 33 2 123 3 acpS Holo-[acyl-carrier-protein] synthase Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
Q820V0 2.51e-12 62 34 4 126 3 acpS Holo-[acyl-carrier-protein] synthase Enterococcus faecalis (strain ATCC 700802 / V583)
Q5WJW1 2.92e-12 62 37 3 126 3 acpS Holo-[acyl-carrier-protein] synthase Shouchella clausii (strain KSM-K16)
A4XBI2 3.45e-12 62 33 2 123 3 acpS Holo-[acyl-carrier-protein] synthase Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / JCM 13857 / NBRC 105044 / CNB-440)
Q5M2S6 4.79e-12 61 35 4 125 3 acpS Holo-[acyl-carrier-protein] synthase Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5LY70 4.79e-12 61 35 4 125 3 acpS Holo-[acyl-carrier-protein] synthase Streptococcus thermophilus (strain CNRZ 1066)
B0K5Y6 4.93e-12 62 30 3 120 3 acpS Holo-[acyl-carrier-protein] synthase Thermoanaerobacter sp. (strain X514)
B0KD52 4.93e-12 62 30 3 120 3 acpS Holo-[acyl-carrier-protein] synthase Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
A9B2B6 5.54e-12 61 39 2 123 3 acpS Holo-[acyl-carrier-protein] synthase Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785 / 114-95)
A7I379 6.35e-12 61 36 3 124 3 acpS Holo-[acyl-carrier-protein] synthase Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
Q30SB4 8.37e-12 60 33 2 121 3 acpS Holo-[acyl-carrier-protein] synthase Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
A8M4B5 1.01e-11 60 32 2 123 3 acpS Holo-[acyl-carrier-protein] synthase Salinispora arenicola (strain CNS-205)
A3CLD6 1.05e-11 60 36 4 127 3 acpS Holo-[acyl-carrier-protein] synthase Streptococcus sanguinis (strain SK36)
A8ERC0 1.4e-11 60 30 2 118 3 acpS Holo-[acyl-carrier-protein] synthase Aliarcobacter butzleri (strain RM4018)
Q034T8 1.75e-11 60 34 4 125 3 acpS Holo-[acyl-carrier-protein] synthase Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
B3WAR1 1.75e-11 60 34 4 125 3 acpS Holo-[acyl-carrier-protein] synthase Lacticaseibacillus casei (strain BL23)
Q8DSF3 2.08e-11 59 33 4 128 3 acpS Holo-[acyl-carrier-protein] synthase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q2RGI1 3.99e-11 59 33 2 121 3 acpS Holo-[acyl-carrier-protein] synthase Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
A9NHV3 6.44e-11 58 32 5 129 3 acpS Holo-[acyl-carrier-protein] synthase Acholeplasma laidlawii (strain PG-8A)
A4VXE0 7.65e-11 58 35 5 126 3 acpS Holo-[acyl-carrier-protein] synthase Streptococcus suis (strain 05ZYH33)
A4W3N6 7.65e-11 58 35 5 126 3 acpS Holo-[acyl-carrier-protein] synthase Streptococcus suis (strain 98HAH33)
A7ZDS5 1.21e-10 57 36 4 124 3 acpS Holo-[acyl-carrier-protein] synthase Campylobacter concisus (strain 13826)
B9KEZ8 1.21e-10 57 31 2 122 3 acpS Holo-[acyl-carrier-protein] synthase Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060)
Q5L623 1.22e-10 57 37 4 124 3 acpS Holo-[acyl-carrier-protein] synthase Chlamydia abortus (strain DSM 27085 / S26/3)
B2G5M8 1.25e-10 57 30 3 126 3 acpS Holo-[acyl-carrier-protein] synthase Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A5VI50 1.25e-10 57 30 3 126 3 acpS Holo-[acyl-carrier-protein] synthase Limosilactobacillus reuteri (strain DSM 20016)
Q6AD33 2.11e-10 57 31 3 126 3 acpS Holo-[acyl-carrier-protein] synthase Leifsonia xyli subsp. xyli (strain CTCB07)
Q03T07 2.11e-10 57 32 5 125 3 acpS Holo-[acyl-carrier-protein] synthase Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
A1WKY6 2.19e-10 57 32 2 120 3 acpS Holo-[acyl-carrier-protein] synthase Verminephrobacter eiseniae (strain EF01-2)
Q8XAN7 2.61e-10 57 34 2 123 3 acpS2 Probable holo-[acyl-carrier-protein] synthase 2 Escherichia coli O157:H7
Q11T75 2.99e-10 57 33 2 127 3 acpS Holo-[acyl-carrier-protein] synthase Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)
Q5SII1 3.16e-10 57 33 5 127 3 acpS Holo-[acyl-carrier-protein] synthase Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q72IV9 3.16e-10 57 33 5 127 3 acpS Holo-[acyl-carrier-protein] synthase Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
Q254H8 4.3e-10 56 30 1 123 3 acpS Holo-[acyl-carrier-protein] synthase Chlamydia felis (strain Fe/C-56)
B2GA64 1.1e-09 55 37 3 87 3 acpS Holo-[acyl-carrier-protein] synthase Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
B6JM38 1.21e-09 55 33 2 123 3 acpS Holo-[acyl-carrier-protein] synthase Helicobacter pylori (strain P12)
O84102 1.3e-09 55 38 4 103 3 acpS Holo-[acyl-carrier-protein] synthase Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
Q3KMS0 1.3e-09 55 38 4 103 3 acpS Holo-[acyl-carrier-protein] synthase Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13)
Q9ZL36 1.93e-09 54 33 2 123 3 acpS Holo-[acyl-carrier-protein] synthase Helicobacter pylori (strain J99 / ATCC 700824)
A6W5X5 1.98e-09 54 29 3 124 3 acpS Holo-[acyl-carrier-protein] synthase Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216)
Q820E7 2.1e-09 54 38 0 83 3 acpS Holo-[acyl-carrier-protein] synthase Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)
O25488 2.24e-09 54 32 2 123 1 acpS Holo-[acyl-carrier-protein] synthase Helicobacter pylori (strain ATCC 700392 / 26695)
B0BB87 2.27e-09 54 38 4 103 3 acpS Holo-[acyl-carrier-protein] synthase Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis)
B0B9K8 2.27e-09 54 38 4 103 3 acpS Holo-[acyl-carrier-protein] synthase Chlamydia trachomatis serovar L2 (strain ATCC VR-902B / DSM 19102 / 434/Bu)
Q1CT62 2.83e-09 54 33 2 121 3 acpS Holo-[acyl-carrier-protein] synthase Helicobacter pylori (strain HPAG1)
Q890W8 3.03e-09 54 35 3 104 3 acpS Holo-[acyl-carrier-protein] synthase Clostridium tetani (strain Massachusetts / E88)
A0R1H6 5.17e-09 53 31 3 132 1 acpS Holo-[acyl-carrier-protein] synthase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
A8MJ27 5.76e-09 53 34 1 97 3 acpS Holo-[acyl-carrier-protein] synthase Alkaliphilus oremlandii (strain OhILAs)
B5Z7H0 6.91e-09 53 31 2 123 3 acpS Holo-[acyl-carrier-protein] synthase Helicobacter pylori (strain G27)
B9MKY6 1.12e-08 52 29 2 123 3 acpS Holo-[acyl-carrier-protein] synthase Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
Q7M803 1.15e-08 52 34 3 120 3 acpS Holo-[acyl-carrier-protein] synthase Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
A0RPF9 1.37e-08 52 32 2 121 3 acpS Holo-[acyl-carrier-protein] synthase Campylobacter fetus subsp. fetus (strain 82-40)
B1MX05 1.38e-08 52 37 2 87 3 acpS Holo-[acyl-carrier-protein] synthase Leuconostoc citreum (strain KM20)
O66995 1.79e-08 52 32 3 125 3 acpS Holo-[acyl-carrier-protein] synthase Aquifex aeolicus (strain VF5)
Q17XL2 3.41e-08 51 31 2 119 3 acpS Holo-[acyl-carrier-protein] synthase Helicobacter acinonychis (strain Sheeba)
B0RD39 4.47e-08 51 36 4 126 3 acpS Holo-[acyl-carrier-protein] synthase Clavibacter sepedonicus
A5CU72 5.88e-08 50 35 4 128 3 acpS Holo-[acyl-carrier-protein] synthase Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382)
Q98R97 6.07e-08 50 32 4 104 3 acpS Holo-[acyl-carrier-protein] synthase Mycoplasmopsis pulmonis (strain UAB CTIP)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_02220
Feature type CDS
Gene acpS
Product Phosphopantetheinyl transferase (holo-ACP synthase)
Location 35422 - 35808 (strand: 1)
Length 387 (nucleotides) / 128 (amino acids)
In genomic island -

Contig

Accession ZDB_680
Length 282413 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_629
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01648 4'-phosphopantetheinyl transferase superfamily

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0736 Lipid transport and metabolism (I) I Phosphopantetheinyl transferase (holo-ACP synthase)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K00997 holo-[acyl-carrier protein] synthase [EC:2.7.8.7] Mycolic acid biosynthesis
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
-

Protein Sequence

MAIVGIGTDIVEISRIEAVIGRSGDRFAKRILSDAEWDVYRLHKQPVRFLAKRFAVKEAASKALGTGIRQGLAFNQFEVSNDSLGKPNLTFLGYAGELAAAREVTHYHVSIADERHYACATVILETNT

Flanking regions ( +/- flanking 50bp)

GCTGCTGCTGTTGCGGATATGAAAACCCTGCTGCGGGAAGCCCGTCGTTAATGGCAATTGTCGGCATTGGTACAGATATTGTTGAAATAAGTCGTATTGAAGCGGTTATCGGGCGTTCCGGCGACCGCTTTGCAAAACGGATCCTCAGTGACGCGGAATGGGACGTGTACCGGCTGCATAAACAGCCGGTGCGTTTTCTGGCCAAACGGTTTGCGGTTAAAGAAGCAGCATCAAAAGCACTGGGGACCGGGATCCGTCAGGGGCTGGCGTTTAACCAGTTTGAAGTCAGTAATGACTCACTCGGCAAACCTAACCTGACCTTTCTCGGCTATGCAGGAGAACTGGCTGCCGCCCGTGAAGTTACACACTACCATGTCTCTATTGCCGACGAGCGTCATTACGCTTGTGCTACGGTTATTCTCGAAACAAACACCTGACAGATGCGCCCTTTGCGGGCGCATCATTACGCTTAAATCTTATCGGCGTG