Homologs in group_3216

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_02800 FBDBKF_02800 100.0 Morganella morganii S1 acrR DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA
EHELCC_03270 EHELCC_03270 100.0 Morganella morganii S2 acrR DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA
NLDBIP_00190 NLDBIP_00190 100.0 Morganella morganii S4 acrR DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA
LHKJJB_01845 LHKJJB_01845 100.0 Morganella morganii S3 acrR DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA

Distribution of the homologs in the orthogroup group_3216

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3216

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P75952 1.01e-19 86 31 5 188 1 comR HTH-type transcriptional repressor ComR Escherichia coli (strain K12)
P39334 2.03e-10 60 27 3 180 1 bdcR HTH-type transcriptional repressor BdcR Escherichia coli (strain K12)
Q7WY76 0.00087 42 26 3 122 4 yezE Uncharacterized HTH-type transcriptional regulator YezE Bacillus subtilis (strain 168)
Q8GLC6 0.001 42 21 4 175 3 icaR Biofilm operon icaADBC HTH-type negative transcriptional regulator IcaR Staphylococcus epidermidis

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_01885
Feature type CDS
Gene acrR
Product DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA
Location 362573 - 363187 (strand: 1)
Length 615 (nucleotides) / 204 (amino acids)
In genomic island -

Contig

Accession ZDB_679
Length 398279 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3216
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Domains

PF00440 Bacterial regulatory proteins, tetR family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1309 Transcription (K) K DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA

Protein Sequence

MAQKGRPRNYDSAAALDKIMAQFWRKGYTATSLDELAAETDMRKPSLYAAFGNKERLYQLAMDRFGEIAQAHYSAALAPQTPGEPLAARLTRWLQATVTLYTGEHGPAGCMVLSTAAAEVYDPAIRKRLQEVIAAQEMMVLDCLNEEKTALHDPDCAPLLAKTLTAFLHSISLRARAGESAGQLAEMVRAGQMVLQSALTSPAA

Flanking regions ( +/- flanking 50bp)

ATGCATGAGGTACAATGATGTAAATTGTTTTTATACTGATCGGTAATCAAATGGCACAAAAAGGCAGACCCCGGAATTACGACAGTGCCGCCGCACTGGATAAAATCATGGCGCAGTTCTGGCGCAAAGGGTATACCGCAACGTCTCTCGATGAACTGGCCGCAGAAACGGACATGAGAAAACCCAGCCTGTACGCCGCTTTTGGTAATAAAGAACGGCTTTACCAGCTGGCAATGGACAGGTTCGGTGAAATCGCTCAGGCGCATTACTCCGCCGCACTGGCACCGCAGACGCCCGGAGAGCCGCTGGCCGCCCGCCTGACCCGCTGGTTACAGGCAACCGTCACCCTTTATACCGGAGAGCACGGCCCTGCAGGATGCATGGTGTTATCGACAGCCGCCGCCGAAGTGTACGACCCTGCCATCCGCAAGCGTCTGCAGGAAGTGATTGCGGCGCAGGAGATGATGGTGCTGGATTGTCTGAATGAAGAGAAAACTGCGCTGCACGATCCGGATTGCGCCCCGCTGCTGGCGAAAACACTGACTGCGTTCCTGCACAGTATTTCCCTGCGCGCCCGGGCCGGTGAAAGTGCCGGGCAACTGGCAGAGATGGTTCGTGCCGGTCAGATGGTATTGCAGTCTGCACTGACATCACCGGCGGCATAATATCCGCCGGTGAGTATTTTTCAGCGCAGTGAAACCTGACCCCGGATACA