Homologs in group_686

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_02650 FBDBKF_02650 100.0 Morganella morganii S1 sugE quaternary ammonium compound efflux SMR transporter SugE
EHELCC_03120 EHELCC_03120 100.0 Morganella morganii S2 sugE quaternary ammonium compound efflux SMR transporter SugE
NLDBIP_00340 NLDBIP_00340 100.0 Morganella morganii S4 sugE quaternary ammonium compound efflux SMR transporter SugE
LHKJJB_01695 LHKJJB_01695 100.0 Morganella morganii S3 sugE quaternary ammonium compound efflux SMR transporter SugE
F4V73_RS05150 F4V73_RS05150 91.5 Morganella psychrotolerans sugE quaternary ammonium compound efflux SMR transporter SugE
PMI_RS17830 PMI_RS17830 53.8 Proteus mirabilis HI4320 sugE quaternary ammonium compound efflux SMR transporter SugE

Distribution of the homologs in the orthogroup group_686

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_686

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q8FAL8 7.51e-35 118 55 0 104 3 gdx Guanidinium exporter Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P69938 1.13e-34 117 55 0 104 3 gdx Guanidinium exporter Shigella flexneri
P69937 1.13e-34 117 55 0 104 1 gdx Guanidinium exporter Escherichia coli (strain K12)
Q8XDQ5 1.13e-34 117 55 0 104 3 gdx Guanidinium exporter Escherichia coli O157:H7
P20928 8.75e-34 115 53 0 104 3 gdx Guanidinium exporter Proteus vulgaris
Q66FD1 2.37e-33 114 54 0 104 3 gdx Guanidinium exporter Yersinia pseudotuberculosis serotype I (strain IP32953)
Q8D1E4 2.37e-33 114 54 0 104 3 gdx Guanidinium exporter Yersinia pestis
Q7MZY0 5.04e-33 113 54 0 104 3 gdx Guanidinium exporter Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q6PT90 1.97e-32 112 52 0 104 3 gdx Guanidinium exporter Salmonella typhimurium
Q6PT86 1.97e-32 112 52 0 104 3 gdx Guanidinium exporter Salmonella thompson
Q79K00 1.97e-32 112 52 0 104 3 gdx Guanidinium exporter Salmonella choleraesuis (strain SC-B67)
Q799A3 1.97e-32 112 52 0 104 3 gdx Guanidinium exporter Klebsiella oxytoca
Q79IF2 1.97e-32 112 52 0 104 3 gdx Guanidinium exporter Escherichia coli
O69279 1.97e-32 112 52 0 104 1 gdx Guanidinium exporter Citrobacter freundii
Q7CP98 4.15e-32 111 53 0 104 3 gdx Guanidinium exporter Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XGT8 4.15e-32 111 53 0 104 3 gdx Guanidinium exporter Salmonella typhi
Q65KV0 5.81e-18 75 43 0 104 3 gdnD Probable guanidinium efflux system subunit GdnD Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
O06999 1.3e-16 72 36 0 106 3 yvdR Uncharacterized membrane protein YvdR Bacillus subtilis (strain 168)
P14319 1.39e-16 72 40 0 102 1 qacC Quaternary ammonium compound-resistance protein QacC Staphylococcus aureus
Q55339 3.14e-16 71 39 0 102 3 qacC Quaternary ammonium compound-resistance protein QacC Staphylococcus sp. (strain ST827)
P0AGD0 5.01e-14 65 33 0 104 3 qacE Quaternary ammonium compound-resistance protein QacE Klebsiella aerogenes
P0AGC9 5.01e-14 65 33 0 104 3 qacE Quaternary ammonium compound-resistance protein QacE Escherichia coli
O32227 3.38e-13 63 35 0 102 3 yvaE Uncharacterized membrane protein YvaE Bacillus subtilis (strain 168)
Q73V87 6.75e-13 62 33 1 103 3 mmr Multidrug resistance protein mmr Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
P49857 1.27e-12 62 35 0 104 1 gdnD Probable guanidinium efflux system subunit GdnD Bacillus subtilis (strain 168)
O87868 1.57e-12 61 36 0 80 3 qacH Quaternary ammonium compound-resistance protein QacH Staphylococcus saprophyticus
P23895 1.81e-12 61 39 0 103 1 emrE Multidrug transporter EmrE Escherichia coli (strain K12)
Q9CBP1 3.37e-11 58 28 1 105 3 mmr Multidrug resistance protein mmr Mycobacterium leprae (strain TN)
P0AA23 4.3e-11 58 39 0 66 3 ebr Putative ethidium bromide resistance protein Salmonella typhimurium
P0AA24 4.3e-11 58 39 0 66 3 ebr Putative ethidium bromide resistance protein Pseudomonas aeruginosa
P0AA22 4.3e-11 58 39 0 66 3 ebr Putative ethidium bromide resistance protein Escherichia coli
O32262 4.88e-11 57 39 2 81 3 yvdS Uncharacterized membrane protein YvdS Bacillus subtilis (strain 168)
Q9X2N9 5.37e-11 57 30 0 103 3 qacF Quaternary ammonium compound-resistance protein QacF Klebsiella aerogenes
P0CW81 9.87e-11 57 31 0 99 1 ebrA Multidrug resistance protein EbrA Bacillus atrophaeus
Q65KV1 4.28e-10 55 30 1 104 3 gdnC Probable guanidinium efflux system subunit GdnC Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q65JB1 4.71e-10 55 29 0 101 3 ebrA Multidrug resistance protein EbrA Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q8GAI6 6.94e-10 56 33 0 102 1 nepB Nicotine metabolites export pump subunit NepB Paenarthrobacter nicotinovorans
Q65JB2 2.28e-09 53 34 0 98 3 ebrB Multidrug resistance protein EbrB Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
P49856 6.54e-09 52 39 2 82 1 gdnC Probable guanidinium efflux system subunit GdnC Bacillus subtilis (strain 168)
P0CW82 8.33e-09 52 31 0 89 3 ebrB Multidrug resistance protein EbrB Bacillus subtilis (strain 168)
O87866 1.03e-08 52 35 0 64 3 qacG Quaternary ammonium compound-resistance protein QacG Staphylococcus sp. (strain ST94)
A1JRE5 1.34e-08 51 29 0 98 3 mdtI Spermidine export protein MdtI Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A4WA58 1.61e-08 51 34 0 84 3 mdtI Spermidine export protein MdtI Enterobacter sp. (strain 638)
Q8GAI5 2.79e-08 50 28 0 102 1 nepA Nicotine metabolites export pump subunit NepA Paenarthrobacter nicotinovorans
B1JLJ7 3e-08 50 29 0 102 3 mdtI Spermidine export protein MdtI Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A4TJI9 3e-08 50 29 0 102 3 mdtI Spermidine export protein MdtI Yersinia pestis (strain Pestoides F)
Q1CJF4 3e-08 50 29 0 102 3 mdtI Spermidine export protein MdtI Yersinia pestis bv. Antiqua (strain Nepal516)
A9QYW1 3e-08 50 29 0 102 3 mdtI Spermidine export protein MdtI Yersinia pestis bv. Antiqua (strain Angola)
Q0WF87 3e-08 50 29 0 102 3 mdtI Spermidine export protein MdtI Yersinia pestis
Q1C803 3e-08 50 29 0 102 3 mdtI Spermidine export protein MdtI Yersinia pestis bv. Antiqua (strain Antiqua)
A7FIB4 3e-08 50 29 0 102 3 mdtI Spermidine export protein MdtI Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
P9WGF1 3.68e-08 50 32 1 87 1 mmr Multidrug resistance protein Mmr Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGF0 3.68e-08 50 32 1 87 3 mmr Multidrug resistance protein Mmr Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P69927 3.68e-08 50 32 1 87 3 mmr Multidrug resistance protein mmr Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q66AS8 3.96e-08 50 29 0 102 3 mdtI Spermidine export protein MdtI Yersinia pseudotuberculosis serotype I (strain IP32953)
B2K337 3.96e-08 50 29 0 102 3 mdtI Spermidine export protein MdtI Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A8AGX4 1.01e-07 49 30 0 91 3 mdtI Spermidine export protein MdtI Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
P0CW83 1.09e-07 49 31 1 95 1 ebrB Multidrug resistance protein EbrB Bacillus atrophaeus
Q7CQK0 1.2e-07 49 29 0 84 3 mdtI Spermidine export protein MdtI Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XG16 1.2e-07 49 29 0 84 3 mdtI Spermidine export protein MdtI Salmonella typhi
B4TVE9 1.2e-07 49 29 0 84 3 mdtI Spermidine export protein MdtI Salmonella schwarzengrund (strain CVM19633)
C0Q4Y4 1.2e-07 49 29 0 84 3 mdtI Spermidine export protein MdtI Salmonella paratyphi C (strain RKS4594)
A9MZZ2 1.2e-07 49 29 0 84 3 mdtI Spermidine export protein MdtI Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
P0C7H7 1.2e-07 49 29 0 84 3 mdtI Spermidine export protein MdtI Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T5B9 1.2e-07 49 29 0 84 3 mdtI Spermidine export protein MdtI Salmonella newport (strain SL254)
B4THR4 1.2e-07 49 29 0 84 3 mdtI Spermidine export protein MdtI Salmonella heidelberg (strain SL476)
B5QUE3 1.2e-07 49 29 0 84 3 mdtI Spermidine export protein MdtI Salmonella enteritidis PT4 (strain P125109)
B5FHS1 1.2e-07 49 29 0 84 3 mdtI Spermidine export protein MdtI Salmonella dublin (strain CT_02021853)
Q57PF4 1.2e-07 49 29 0 84 3 mdtI Spermidine export protein MdtI Salmonella choleraesuis (strain SC-B67)
B5F6G3 1.2e-07 49 29 0 84 3 mdtI Spermidine export protein MdtI Salmonella agona (strain SL483)
A9MRT8 1.34e-07 48 30 0 84 3 mdtI Spermidine export protein MdtI Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q9HUH5 1.99e-07 48 34 2 83 1 PA4990 Multidrug transporter PA4990 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A8GFH6 5.96e-07 47 31 0 91 3 mdtI Spermidine export protein MdtI Serratia proteamaculans (strain 568)
P0CW80 1.03e-06 46 29 0 81 3 ebrA Multidrug resistance protein EbrA Bacillus subtilis (strain 168)
Q32G65 1.33e-06 46 30 0 90 3 mdtI Spermidine export protein MdtI Shigella dysenteriae serotype 1 (strain Sd197)
B5XR94 1.52e-06 46 29 0 84 3 mdtI Spermidine export protein MdtI Klebsiella pneumoniae (strain 342)
A6T8S6 2.01e-06 45 29 0 84 3 mdtI Spermidine export protein MdtI Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q2NVC0 1.88e-05 43 27 0 99 3 mdtJ Spermidine export protein MdtJ Sodalis glossinidius (strain morsitans)
Q3Z1V2 4.03e-05 42 30 0 91 3 mdtI Spermidine export protein MdtI Shigella sonnei (strain Ss046)
Q0T4H8 4.03e-05 42 30 0 91 3 mdtI Spermidine export protein MdtI Shigella flexneri serotype 5b (strain 8401)
Q320V5 4.03e-05 42 30 0 91 3 mdtI Spermidine export protein MdtI Shigella boydii serotype 4 (strain Sb227)
B2U1Q8 4.03e-05 42 30 0 91 3 mdtI Spermidine export protein MdtI Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q1RBJ9 4.03e-05 42 30 0 91 3 mdtI Spermidine export protein MdtI Escherichia coli (strain UTI89 / UPEC)
B1LET7 4.03e-05 42 30 0 91 3 mdtI Spermidine export protein MdtI Escherichia coli (strain SMS-3-5 / SECEC)
B6IB33 4.03e-05 42 30 0 91 3 mdtI Spermidine export protein MdtI Escherichia coli (strain SE11)
B7NB49 4.03e-05 42 30 0 91 3 mdtI Spermidine export protein MdtI Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P69210 4.03e-05 42 30 0 91 1 mdtI Spermidine export protein MdtI Escherichia coli (strain K12)
B1IQZ1 4.03e-05 42 30 0 91 3 mdtI Spermidine export protein MdtI Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A1ABE4 4.03e-05 42 30 0 91 3 mdtI Spermidine export protein MdtI Escherichia coli O1:K1 / APEC
A8A0E0 4.03e-05 42 30 0 91 3 mdtI Spermidine export protein MdtI Escherichia coli O9:H4 (strain HS)
B1XF64 4.03e-05 42 30 0 91 3 mdtI Spermidine export protein MdtI Escherichia coli (strain K12 / DH10B)
C4ZY62 4.03e-05 42 30 0 91 3 mdtI Spermidine export protein MdtI Escherichia coli (strain K12 / MC4100 / BW2952)
B7LZZ1 4.03e-05 42 30 0 91 3 mdtI Spermidine export protein MdtI Escherichia coli O8 (strain IAI1)
B7NUP0 4.03e-05 42 30 0 91 3 mdtI Spermidine export protein MdtI Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5Z435 4.03e-05 42 30 0 91 3 mdtI Spermidine export protein MdtI Escherichia coli O157:H7 (strain EC4115 / EHEC)
P69211 4.03e-05 42 30 0 91 3 mdtI Spermidine export protein MdtI Escherichia coli O157:H7
B7L5F1 4.03e-05 42 30 0 91 3 mdtI Spermidine export protein MdtI Escherichia coli (strain 55989 / EAEC)
B7M9V2 4.03e-05 42 30 0 91 3 mdtI Spermidine export protein MdtI Escherichia coli O45:K1 (strain S88 / ExPEC)
B7URT9 4.03e-05 42 30 0 91 3 mdtI Spermidine export protein MdtI Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZM58 4.03e-05 42 30 0 91 3 mdtI Spermidine export protein MdtI Escherichia coli O139:H28 (strain E24377A / ETEC)
Q8FHB5 5.54e-05 42 30 0 84 3 mdtI Spermidine export protein MdtI Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8FHB4 9.24e-05 42 26 0 99 3 mdtJ Spermidine export protein MdtJ Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q7N537 0.000108 42 28 0 99 3 mdtJ Spermidine export protein MdtJ Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A9MRT9 0.000113 41 26 0 99 3 mdtJ Spermidine export protein MdtJ Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q3Z1V3 0.000138 41 26 0 99 3 mdtJ Spermidine export protein MdtJ Shigella sonnei (strain Ss046)
P69214 0.000138 41 26 0 99 3 mdtJ Spermidine export protein MdtJ Shigella flexneri
Q0T4H7 0.000138 41 26 0 99 3 mdtJ Spermidine export protein MdtJ Shigella flexneri serotype 5b (strain 8401)
Q32G66 0.000138 41 26 0 99 3 mdtJ Spermidine export protein MdtJ Shigella dysenteriae serotype 1 (strain Sd197)
Q320V6 0.000138 41 26 0 99 3 mdtJ Spermidine export protein MdtJ Shigella boydii serotype 4 (strain Sb227)
B2U1Q9 0.000138 41 26 0 99 3 mdtJ Spermidine export protein MdtJ Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q1RBJ8 0.000138 41 26 0 99 3 mdtJ Spermidine export protein MdtJ Escherichia coli (strain UTI89 / UPEC)
B1LET6 0.000138 41 26 0 99 3 mdtJ Spermidine export protein MdtJ Escherichia coli (strain SMS-3-5 / SECEC)
B6IB34 0.000138 41 26 0 99 3 mdtJ Spermidine export protein MdtJ Escherichia coli (strain SE11)
P69212 0.000138 41 26 0 99 1 mdtJ Spermidine export protein MdtJ Escherichia coli (strain K12)
B1IQZ0 0.000138 41 26 0 99 3 mdtJ Spermidine export protein MdtJ Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q0THM8 0.000138 41 26 0 99 3 mdtJ Spermidine export protein MdtJ Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1ABE5 0.000138 41 26 0 99 3 mdtJ Spermidine export protein MdtJ Escherichia coli O1:K1 / APEC
A8A0E1 0.000138 41 26 0 99 3 mdtJ Spermidine export protein MdtJ Escherichia coli O9:H4 (strain HS)
B1XF65 0.000138 41 26 0 99 3 mdtJ Spermidine export protein MdtJ Escherichia coli (strain K12 / DH10B)
C4ZY63 0.000138 41 26 0 99 3 mdtJ Spermidine export protein MdtJ Escherichia coli (strain K12 / MC4100 / BW2952)
B7LZZ2 0.000138 41 26 0 99 3 mdtJ Spermidine export protein MdtJ Escherichia coli O8 (strain IAI1)
B7MV46 0.000138 41 26 0 99 3 mdtJ Spermidine export protein MdtJ Escherichia coli O81 (strain ED1a)
B5Z436 0.000138 41 26 0 99 3 mdtJ Spermidine export protein MdtJ Escherichia coli O157:H7 (strain EC4115 / EHEC)
P69213 0.000138 41 26 0 99 3 mdtJ Spermidine export protein MdtJ Escherichia coli O157:H7
B7L5F2 0.000138 41 26 0 99 3 mdtJ Spermidine export protein MdtJ Escherichia coli (strain 55989 / EAEC)
B7M9V3 0.000138 41 26 0 99 3 mdtJ Spermidine export protein MdtJ Escherichia coli O45:K1 (strain S88 / ExPEC)
A7ZM59 0.000138 41 26 0 99 3 mdtJ Spermidine export protein MdtJ Escherichia coli O139:H28 (strain E24377A / ETEC)
B7URU0 0.000142 41 26 0 99 3 mdtJ Spermidine export protein MdtJ Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q7N536 0.000192 40 29 0 84 3 mdtI Spermidine export protein MdtI Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q83RD1 0.000213 40 29 0 91 3 mdtI Spermidine export protein MdtI Shigella flexneri
Q0THM9 0.000216 40 30 0 91 3 mdtI Spermidine export protein MdtI Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7MV45 0.000216 40 30 0 91 3 mdtI Spermidine export protein MdtI Escherichia coli O81 (strain ED1a)
B5F6G4 0.000279 40 26 0 99 3 mdtJ Spermidine export protein MdtJ Salmonella agona (strain SL483)
Q7CQK1 0.000303 40 26 0 99 3 mdtJ Spermidine export protein MdtJ Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XEK5 0.000303 40 26 0 99 3 mdtJ Spermidine export protein MdtJ Salmonella typhi
C0Q4Y5 0.000303 40 26 0 99 3 mdtJ Spermidine export protein MdtJ Salmonella paratyphi C (strain RKS4594)
A9MZZ3 0.000303 40 26 0 99 3 mdtJ Spermidine export protein MdtJ Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4T5B8 0.000303 40 26 0 99 3 mdtJ Spermidine export protein MdtJ Salmonella newport (strain SL254)
B4THR3 0.000303 40 26 0 99 3 mdtJ Spermidine export protein MdtJ Salmonella heidelberg (strain SL476)
B5QUE4 0.000303 40 26 0 99 3 mdtJ Spermidine export protein MdtJ Salmonella enteritidis PT4 (strain P125109)
B5FHS2 0.000303 40 26 0 99 3 mdtJ Spermidine export protein MdtJ Salmonella dublin (strain CT_02021853)
Q57PF5 0.000303 40 26 0 99 3 mdtJ Spermidine export protein MdtJ Salmonella choleraesuis (strain SC-B67)
B4TVE8 0.000326 40 26 0 99 3 mdtJ Spermidine export protein MdtJ Salmonella schwarzengrund (strain CVM19633)
B5BK90 0.000326 40 26 0 99 3 mdtJ Spermidine export protein MdtJ Salmonella paratyphi A (strain AKU_12601)
Q5PHJ7 0.000326 40 26 0 99 3 mdtJ Spermidine export protein MdtJ Salmonella paratyphi A (strain ATCC 9150 / SARB42)
A8GFH7 0.000549 39 25 0 99 3 mdtJ Spermidine export protein MdtJ Serratia proteamaculans (strain 568)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_01735
Feature type CDS
Gene sugE
Product quaternary ammonium compound efflux SMR transporter SugE
Location 333619 - 333939 (strand: -1)
Length 321 (nucleotides) / 106 (amino acids)

Contig

Accession ZDB_679
Length 398279 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_686
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00893 Small Multidrug Resistance protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2076 Defense mechanisms (V) V Multidrug transporter EmrE and related cation transporters

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K11741 quaternary ammonium compound-resistance protein SugE - -

Protein Sequence

MPWILLITAGLFEVVWAFTMKQSEGFTKVGPSVITIIAMLISFGLLAMAMRALPLGTAYTIWTGIGAIGAFIVGIVVLGEPANMMRIIAGVLIISGLVMMKLASPA

Flanking regions ( +/- flanking 50bp)

GGTAACTTATAAACGTATCACCTGCAACCAGAAATCAGTGAGGATGTACCATGCCGTGGATTTTATTAATTACTGCCGGATTATTTGAAGTCGTCTGGGCATTTACCATGAAACAATCAGAGGGTTTCACCAAAGTGGGGCCGTCAGTGATCACCATTATTGCCATGCTGATAAGCTTCGGGCTGCTGGCAATGGCCATGCGGGCACTGCCGCTGGGGACGGCTTACACCATCTGGACCGGGATTGGCGCTATCGGTGCCTTTATCGTCGGGATTGTGGTGCTGGGTGAACCGGCAAACATGATGCGGATTATCGCAGGGGTATTAATTATCTCCGGGCTGGTGATGATGAAATTAGCCAGCCCGGCATAAAAGATTCAGTACTGTGTTGCTTGCCGGCAGATATTGCCGGCTTTTTTTGT