Homologs in group_3496

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_17090 FBDBKF_17090 100.0 Morganella morganii S1 - Inner membrane protein
EHELCC_01800 EHELCC_01800 100.0 Morganella morganii S2 - Inner membrane protein
NLDBIP_01660 NLDBIP_01660 100.0 Morganella morganii S4 - Inner membrane protein
LHKJJB_00375 LHKJJB_00375 100.0 Morganella morganii S3 - Inner membrane protein

Distribution of the homologs in the orthogroup group_3496

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3496

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_00415
Feature type CDS
Gene -
Product Inner membrane protein
Location 71802 - 71978 (strand: -1)
Length 177 (nucleotides) / 58 (amino acids)

Contig

Accession ZDB_679
Length 398279 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3496
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Protein Sequence

MLILALYLWIAGYLFAELSRSADTRTDIAAVMLYSTLWLPVGACYLSSLIASKVLGDE

Flanking regions ( +/- flanking 50bp)

GCGGCGACGATGACGCACAGAACAAGCGCAAAAACGGATAGGAGGCACTGATGCTGATCCTTGCACTCTATCTGTGGATTGCCGGTTATCTCTTCGCAGAACTGAGCAGAAGCGCAGATACCCGCACCGACATAGCCGCCGTGATGCTTTATTCCACACTCTGGCTGCCGGTCGGCGCGTGTTATCTTTCATCCCTGATCGCCAGCAAAGTGTTAGGCGACGAGTAATTACCCCGCTTTACCCTCTTCAATCCACCCGTCAACCATATCGGCCCACT