Homologs in group_323

Help

7 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_12720 FBDBKF_12720 72.2 Morganella morganii S1 - Phage protein
FBDBKF_17265 FBDBKF_17265 100.0 Morganella morganii S1 - Phage protein
EHELCC_01625 EHELCC_01625 100.0 Morganella morganii S2 - Phage protein
NLDBIP_01835 NLDBIP_01835 100.0 Morganella morganii S4 - Phage protein
LHKJJB_00200 LHKJJB_00200 100.0 Morganella morganii S3 - Phage protein
F4V73_RS06060 F4V73_RS06060 78.4 Morganella psychrotolerans - hypothetical protein
PMI_RS08400 PMI_RS08400 47.4 Proteus mirabilis HI4320 - hypothetical protein

Distribution of the homologs in the orthogroup group_323

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_323

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_00240
Feature type CDS
Gene -
Product Phage protein
Location 41500 - 41793 (strand: 1)
Length 294 (nucleotides) / 97 (amino acids)
In genomic island -

Contig

Accession ZDB_679
Length 398279 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_323
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF22479 Domain of unknown function (DUF6983)

Protein Sequence

MKIIPLNTVPNQRLRVTLNEQEWELTIKTAHGVMCCDIRCDDEIVVQGMRMLPEQPLIPYRYLTSDGNFTLLTGGDALPWWEQFGKTQTLVWRGDDD

Flanking regions ( +/- flanking 50bp)

TCTGTTGCCGTAAAACTTGCCGGCGGGGCTGCCGGTAAACCGGGGGGCAAATGAAAATTATACCACTGAATACCGTGCCGAATCAGCGCCTGCGGGTCACGCTGAATGAACAGGAATGGGAACTGACAATCAAAACCGCGCACGGAGTGATGTGCTGTGATATCCGCTGCGATGATGAGATTGTTGTGCAGGGGATGCGGATGCTGCCGGAGCAGCCGCTGATCCCGTACCGCTATCTTACGTCAGACGGCAATTTTACGTTACTGACCGGCGGGGACGCATTGCCCTGGTGGGAACAGTTCGGAAAAACACAGACACTGGTCTGGCGGGGGGATGATGATTGACTTACGCAGGATCCGCTGCGCCATCGAGGTTAACGGTCGCCTGCAATGGT