Homologs in group_2445

Help

6 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_20310 FBDBKF_20310 63.6 Morganella morganii S1 - IS3 family transposase
EHELCC_19060 EHELCC_19060 63.6 Morganella morganii S2 - IS3 family transposase
EHELCC_19845 EHELCC_19845 100.0 Morganella morganii S2 insE IS3 family transposase
NLDBIP_19535 NLDBIP_19535 63.6 Morganella morganii S4 - IS3 family transposase
LHKJJB_19530 LHKJJB_19530 63.6 Morganella morganii S3 - IS3 family transposase
HKOGLL_19415 HKOGLL_19415 63.6 Morganella morganii S5 - IS3 family transposase

Distribution of the homologs in the orthogroup group_2445

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2445

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P9WKH8 7.78e-28 111 28 6 259 3 MT1803 Putative transposase for insertion sequence element IS986/IS6110 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P9WKH9 1.26e-27 110 29 7 259 4 Rv0796 Putative transposase for insertion sequence element IS986/IS6110 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
A5TY79 1.26e-27 110 29 7 259 3 MRA_0011 Putative transposase for insertion sequence element IS986/IS6110 Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
P59800 1.26e-27 110 29 7 259 3 BQ2027_MB2838C Putative transposase for insertion sequence element IS986/IS6110 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P35878 8.36e-27 108 32 5 207 3 nisX1 Transposase for insertion sequence element IS904 Lactococcus lactis subsp. lactis (strain IL1403)
P16942 2.23e-25 105 30 4 217 4 None Transposase for insertion sequence element IS629 Shigella sonnei
P0CF85 3.87e-24 101 31 3 216 3 insF Transposase InsF for insertion sequence IS3 Escherichia coli O111:H-
P0CF84 3.87e-24 101 31 3 216 3 insF6 Transposase InsF for insertion sequence IS3fA Escherichia coli (strain K12)
P0CF83 3.87e-24 101 31 3 216 3 insF5 Transposase InsF for insertion sequence IS3E Escherichia coli (strain K12)
P0CF82 3.87e-24 101 31 3 216 3 insF4 Transposase InsF for insertion sequence IS3D Escherichia coli (strain K12)
P0CF81 3.87e-24 101 31 3 216 3 insF3 Transposase InsF for insertion sequence IS3C Escherichia coli (strain K12)
P0CF80 3.87e-24 101 31 3 216 3 insF2 Transposase InsF for insertion sequence IS3B Escherichia coli (strain K12)
P0CF79 3.87e-24 101 31 3 216 3 insF1 Transposase InsF for insertion sequence IS3A Escherichia coli (strain K12)
Q9JMT3 7e-23 98 32 3 212 3 insF7 Transposase InsF for insertion sequence IS3fB Escherichia coli (strain K12)
P16940 3.35e-21 93 29 10 264 4 None Insertion element IS600 uncharacterized 31 kDa protein Shigella sonnei
P19769 8.29e-21 92 29 7 239 2 insK Putative transposase InsK for insertion sequence element IS150 Escherichia coli (strain K12)
P25438 1.84e-17 84 28 4 251 4 None Insertion element IS476 uncharacterized 39.2 kDa protein Xanthomonas euvesicatoria
P24577 3.85e-16 79 25 4 243 4 Bmul_4719 Insertion element IS407 uncharacterized 31.7 kDa protein Burkholderia multivorans (strain ATCC 17616 / 249)
P11257 1.34e-15 77 36 4 131 4 None Transposase for insertion sequence element IS3411 Escherichia coli
O05086 2.24e-15 76 25 3 191 3 HI_1721 Uncharacterized transposase-like protein HI_1721 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q47718 1.04e-14 74 33 5 144 5 insO2 Putative transposase InsO for insertion sequence element IS911B Escherichia coli (strain K12)
Q79CE8 1.25e-10 65 25 5 211 3 None Probable transposase for insertion sequence element IS1353 Shigella flexneri
P75680 9.46e-07 50 34 8 121 5 insO1 Putative transposase InsO for insertion sequence element IS911A Escherichia coli (strain K12)
P31795 0.000202 46 26 2 197 3 pol Pol polyprotein (Fragment) Radiation murine leukemia virus (strain Kaplan)
Q06715 0.000372 45 30 1 78 4 None ATP-dependent protease Lactococcus lactis subsp. lactis
P31623 0.000401 45 26 3 118 3 pol Gag-Pro-Pol polyprotein Sheep pulmonary adenomatosis virus
P0C211 0.000621 45 31 4 102 1 gag-pro-pol Gag-Pro-Pol polyprotein Human T-cell leukemia virus 1 (isolate Melanesia mel5 subtype C)
P25059 0.00078 44 31 2 89 1 pol Gag-Pro-Pol polyprotein Bovine leukemia virus (isolate Australian)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_20515
Feature type CDS
Gene insE
Product IS3 family transposase
Location 21 - 869 (strand: -1)
Length 849 (nucleotides) / 282 (amino acids)

Contig

Accession contig_60
Length 2854 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2445
Orthogroup size 7
N. genomes 5

Actions

Genomic region

Domains

PF00665 Integrase core domain
PF13276 HTH-like domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2801 Mobilome: prophages, transposons (X) X Transposase InsO and inactivated derivatives

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07497 putative transposase - -

Protein Sequence

MIDREHKLSVVRQAKLLGFSRGSVYYLPRPVSDGDLALMRRIDELHLDYPFAGSRMLQGLLRGEGLETGRRHVATLMKKMGIKAIYRRPNTSKPAPGHIRKLAVTRPNQVWAMDLTYIPMARGFVYLCAVVDWFSRKVLSWRLSITMEAAFCIEAVEEALARHGRPEIFNTDQGSQFTSIDFTAVLKRSQIAISMDGKGAWRDNVFVERLWRSIKYEEVYLHAYKTVSEARAGIARYLNFYNTRRPHWHCCKVSDEAAFCLIQRPYISKTLLTRRISPRGSP

Flanking regions ( +/- flanking 50bp)

GATTTTTTATCCGGTGCGCTCGGCAAGGCGGGATTGCTGGGCGGAAAGAAATGATCGACCGCGAGCACAAGCTATCCGTCGTGCGCCAGGCGAAGCTTCTCGGCTTCAGCCGTGGCAGCGTCTACTATCTGCCTCGTCCGGTGTCTGACGGCGATCTGGCCCTTATGCGCCGGATTGACGAATTGCATCTCGACTACCCCTTTGCCGGAAGTCGGATGTTGCAAGGGCTCTTGAGAGGAGAAGGTCTGGAGACCGGGCGGCGACACGTCGCCACGCTGATGAAGAAGATGGGCATCAAGGCGATCTACCGCCGCCCGAACACCTCGAAACCAGCGCCAGGGCACATACGAAAGCTGGCAGTCACCCGGCCCAATCAGGTGTGGGCAATGGACCTGACCTACATCCCCATGGCGCGGGGATTTGTCTATCTGTGCGCCGTCGTGGACTGGTTCAGCCGGAAGGTCTTGTCATGGCGGTTGTCGATCACGATGGAAGCAGCCTTCTGCATCGAGGCGGTGGAGGAGGCACTTGCCCGTCATGGCAGGCCGGAAATCTTCAATACCGACCAGGGATCGCAGTTCACCTCCATCGACTTCACCGCCGTGCTGAAGAGGTCACAGATTGCCATCTCGATGGATGGCAAGGGTGCGTGGCGAGACAATGTCTTCGTCGAGCGGCTCTGGCGTTCGATCAAATACGAGGAAGTCTACCTCCATGCCTACAAGACTGTGTCCGAGGCACGCGCTGGCATCGCCCGATATCTGAACTTCTACAACACCAGACGCCCACATTGGCACTGTTGCAAAGTTAGCGATGAGGCAGCCTTTTGTCTTATTCAAAGGCCTTACATTTCAAAAACTCTGCTTACCAGGCGCATTTCGCCCAGGGGATCACCATAATAAAATGCTGAGGCCTGGCC