Homologs in group_3780
1 homologs were identified in 1 genome with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.
| Locus tag | Identity | Source | Gene | Product | |
|---|---|---|---|---|---|
| EHELCC_19605 | EHELCC_19605 | 100.0 | Morganella morganii S2 | tnpA | Tn3 family transposase |
Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).
| Swissprot accession | Eval | Score | ID (%) | N gaps | Alignment length | Annot score | Gene | Description | Organism |
|---|---|---|---|---|---|---|---|---|---|
| P03008 | 1.17e-44 | 155 | 98 | 0 | 71 | 3 | tnpA | Transposase for transposon Tn3 | Escherichia coli |
| Q00037 | 5.78e-27 | 104 | 63 | 0 | 71 | 3 | tnpA | Transposase for transposon gamma-delta | Escherichia coli (strain K12) |
| P13694 | 0.000148 | 41 | 39 | 1 | 61 | 3 | tnpA | Transposase for transposon Tn3926 | Escherichia coli |
| Q06238 | 0.000208 | 40 | 35 | 1 | 60 | 3 | None | Transposase for transposon Tn1546 | Enterococcus faecium |
| Source | Morganella morganii S1 |
|---|---|
| Locus tag | FBDBKF_20240 |
| Feature type | CDS |
| Gene | tnpA |
| Product | Tn3 family transposase |
| Location | 5192 - 5410 (strand: 1) |
| Length | 219 (nucleotides) / 72 (amino acids) |
| Accession | contig_49 |
|---|---|
| Length | 10748 nucleotides |
| Topology | linear |
| Plasmid | False |
| Orthogroup | group_3780 | |
|---|---|---|
| Orthogroup size | 2 | |
| N. genomes | 2 |
| PF13700 | Domain of unknown function (DUF4158) |
|---|
MPVDFLTTEQTESYGRFTGEPDELQLARYFHLDEADKEFIGKSRGDHNRLGIALQIGCVRFLGTFLTDMNHT
CGTACGGTTGGAAAAATGTTACTAAATGCCCGTCAGGCAGGGAGGCCGATATGCCCGTTGACTTTCTGACCACTGAGCAGACTGAAAGCTATGGCAGATTCACCGGTGAACCGGATGAGCTTCAGCTGGCACGATATTTTCACCTTGATGAAGCAGACAAGGAATTTATCGGAAAAAGCAGAGGTGATCACAACCGTCTGGGCATTGCCCTGCAAATTGGATGTGTCCGTTTTCTGGGCACCTTCCTCACCGATATGAATCATACCTAGATTCTACGTCAGTACTTCAAAAAGCATAATCAAAGCCTTGATAAATATGC
