Homologs in group_3596

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_07730 EHELCC_07730 100.0 Morganella morganii S2 - hypothetical protein
NLDBIP_08055 NLDBIP_08055 100.0 Morganella morganii S4 - hypothetical protein
LHKJJB_06210 LHKJJB_06210 100.0 Morganella morganii S3 - hypothetical protein
HKOGLL_19065 HKOGLL_19065 100.0 Morganella morganii S5 - hypothetical protein

Distribution of the homologs in the orthogroup group_3596

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3596

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_19885
Feature type CDS
Gene -
Product hypothetical protein
Location 2483 - 2611 (strand: -1)
Length 129 (nucleotides) / 42 (amino acids)
In genomic island -

Contig

Accession contig_45
Length 15421 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3596
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Protein Sequence

MKSGTIKYGVISLLFLTLTGVASADVYRDRSGIVTGTQQKQN

Flanking regions ( +/- flanking 50bp)

AGGCTATTTTACGTGAAACTCATTACTGTATAACCACAGAGGTGTTGATAATGAAATCCGGTACAATAAAGTATGGTGTTATCAGTCTGCTCTTTCTGACTTTAACAGGCGTTGCGAGTGCGGATGTTTATCGTGATCGCAGCGGTATTGTAACCGGAACACAGCAGAAGCAAAATTAATGACACGGACAGAGAAATGGTGTTCTGGTGTCCCCTGCAGGAATCGACTA