Homologs in group_2424

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_16500 EHELCC_16500 100.0 Morganella morganii S2 zur zinc uptake transcriptional repressor Zur
NLDBIP_16710 NLDBIP_16710 100.0 Morganella morganii S4 zur zinc uptake transcriptional repressor Zur
LHKJJB_16760 LHKJJB_16760 100.0 Morganella morganii S3 zur zinc uptake transcriptional repressor Zur
HKOGLL_18855 HKOGLL_18855 100.0 Morganella morganii S5 zur zinc uptake transcriptional repressor Zur
F4V73_RS18570 F4V73_RS18570 92.9 Morganella psychrotolerans zur zinc uptake transcriptional repressor Zur
PMI_RS13545 PMI_RS13545 59.2 Proteus mirabilis HI4320 zur zinc uptake transcriptional repressor Zur

Distribution of the homologs in the orthogroup group_2424

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2424

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AC52 7.26e-65 199 55 0 162 3 zur Zinc uptake regulation protein Shigella flexneri
P0AC51 7.26e-65 199 55 0 162 1 zur Zinc uptake regulation protein Escherichia coli (strain K12)
Q49YQ6 4.93e-08 52 25 3 131 3 perR Peroxide-responsive repressor PerR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q4L7G4 4.2e-07 50 24 4 151 3 perR Peroxide-responsive repressor PerR Staphylococcus haemolyticus (strain JCSC1435)
Q8CNQ7 4.46e-07 50 24 4 147 3 perR Peroxide-responsive repressor PerR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HN74 4.46e-07 50 24 4 147 3 perR Peroxide-responsive repressor PerR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q7A0J4 5.87e-07 50 25 4 156 3 perR Peroxide-responsive repressor PerR Staphylococcus aureus (strain MW2)
Q9RQL3 5.87e-07 50 25 4 156 3 perR Peroxide-responsive repressor PerR Staphylococcus aureus
Q6G873 5.87e-07 50 25 4 156 3 perR Peroxide-responsive repressor PerR Staphylococcus aureus (strain MSSA476)
Q6GFJ6 5.87e-07 50 25 4 156 3 perR Peroxide-responsive repressor PerR Staphylococcus aureus (strain MRSA252)
Q5HER3 5.87e-07 50 25 4 156 3 perR Peroxide-responsive repressor PerR Staphylococcus aureus (strain COL)
Q2YU25 5.87e-07 50 25 4 156 3 perR Peroxide-responsive repressor PerR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2G282 5.87e-07 50 25 4 156 1 perR Peroxide-responsive repressor PerR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FFN4 5.87e-07 50 25 4 156 3 perR Peroxide-responsive repressor PerR Staphylococcus aureus (strain USA300)
Q7A4T8 9.48e-07 49 25 4 156 3 perR Peroxide-responsive repressor PerR Staphylococcus aureus (strain N315)
Q99T18 9.48e-07 49 25 4 156 3 perR Peroxide-responsive repressor PerR Staphylococcus aureus (strain Mu50 / ATCC 700699)
P71086 1.22e-05 46 22 1 137 1 perR Peroxide operon regulator Bacillus subtilis (strain 168)
Q46463 7.25e-05 44 20 2 148 3 fur Ferric uptake regulation protein Campylobacter upsaliensis
P54574 0.000441 42 23 3 138 1 fur Ferric uptake regulation protein Bacillus subtilis (strain 168)
P0A034 0.000619 41 25 5 132 3 fur Ferric uptake regulation protein Staphylococcus aureus (strain MW2)
P0C1Q1 0.000619 41 25 5 132 3 fur Ferric uptake regulation protein Staphylococcus aureus
Q6G912 0.000619 41 25 5 132 3 fur Ferric uptake regulation protein Staphylococcus aureus (strain MSSA476)
Q6GGE5 0.000619 41 25 5 132 3 fur Ferric uptake regulation protein Staphylococcus aureus (strain MRSA252)
P0A033 0.000619 41 25 5 132 3 fur Ferric uptake regulation protein Staphylococcus aureus (strain N315)
P0A032 0.000619 41 25 5 132 3 fur Ferric uptake regulation protein Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HFK6 0.000619 41 25 5 132 3 fur Ferric uptake regulation protein Staphylococcus aureus (strain COL)
Q2FY19 0.000619 41 25 5 132 3 fur Ferric uptake regulation protein Staphylococcus aureus (strain NCTC 8325 / PS 47)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_19555
Feature type CDS
Gene zur
Product zinc uptake transcriptional repressor Zur
Location 18293 - 18811 (strand: -1)
Length 519 (nucleotides) / 172 (amino acids)

Contig

Accession contig_41
Length 20756 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2424
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01475 Ferric uptake regulator family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0735 Inorganic ion transport and metabolism (P) P Fe2+ or Zn2+ uptake regulation protein Fur/Zur

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K09823 Fur family transcriptional regulator, zinc uptake regulator Quorum sensing -

Protein Sequence

MQSVDIQTLLKKAEALCLSRSVRMTSQRKSILQLIAGQPGAISAYELLDLLRETEPQAKPPTIYRGLEFLLEQGFIHKIESTNSFVMCPHFDKPSHTSVLFICDRCNSVTERDGEAIDSQITQLADAAQFHIRHSVIEAHGYCRPCYDIESCTRRDKCLHDHEHDEPRKHGR

Flanking regions ( +/- flanking 50bp)

ATGTTAGAGTGAGCTGTTCATATATTTATTGATTAGCGGAAGGTGATGTCATGCAATCTGTTGATATTCAGACTTTATTAAAAAAAGCAGAAGCGCTGTGTCTGTCACGCAGTGTGCGCATGACGTCTCAGCGAAAGTCGATTCTGCAGCTGATTGCCGGCCAGCCCGGAGCCATCAGTGCTTATGAGCTGCTGGATCTGCTGCGCGAAACCGAGCCGCAGGCAAAACCGCCGACAATCTACCGCGGCCTGGAATTTCTGCTGGAGCAGGGATTTATTCACAAAATTGAGTCCACCAACAGCTTTGTGATGTGCCCGCATTTTGATAAACCCAGCCATACTTCAGTACTGTTTATCTGCGATCGCTGTAACAGTGTGACAGAGCGGGACGGAGAGGCGATTGATTCACAAATCACTCAGTTGGCGGATGCCGCGCAATTTCATATCCGCCACAGTGTGATTGAGGCGCACGGATACTGCCGCCCTTGTTATGATATTGAATCCTGCACCCGCAGAGATAAATGCCTGCATGACCACGAACATGACGAACCGCGTAAACACGGACGCTGAAAAACAAAAACCACAGTGTCCGTCTCCGGCGTACTGTGGTTTTTAAGCGG