Homologs in group_2406

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_18860 EHELCC_18860 100.0 Morganella morganii S2 rplQ 50S ribosomal protein L17
NLDBIP_18875 NLDBIP_18875 100.0 Morganella morganii S4 rplQ 50S ribosomal protein L17
LHKJJB_18730 LHKJJB_18730 100.0 Morganella morganii S3 rplQ 50S ribosomal protein L17
HKOGLL_18465 HKOGLL_18465 100.0 Morganella morganii S5 rplQ 50S ribosomal protein L17
F4V73_RS19050 F4V73_RS19050 98.4 Morganella psychrotolerans rplQ 50S ribosomal protein L17
PMI_RS16275 PMI_RS16275 94.5 Proteus mirabilis HI4320 rplQ 50S ribosomal protein L17

Distribution of the homologs in the orthogroup group_2406

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2406

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
A6TEU7 6.74e-87 251 96 0 128 3 rplQ Large ribosomal subunit protein bL17 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XNB7 6.74e-87 251 96 0 128 3 rplQ Large ribosomal subunit protein bL17 Klebsiella pneumoniae (strain 342)
A4WFA2 7.77e-87 251 95 0 128 3 rplQ Large ribosomal subunit protein bL17 Enterobacter sp. (strain 638)
A8GKH2 1.47e-86 250 96 0 126 3 rplQ Large ribosomal subunit protein bL17 Serratia proteamaculans (strain 568)
B2VK70 1.91e-86 250 95 0 128 3 rplQ Large ribosomal subunit protein bL17 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
B4F1L0 5.54e-86 249 94 0 128 3 rplQ Large ribosomal subunit protein bL17 Proteus mirabilis (strain HI4320)
Q7CPL7 9.28e-86 248 96 1 128 3 rplQ Large ribosomal subunit protein bL17 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XF03 9.28e-86 248 96 1 128 3 rplQ Large ribosomal subunit protein bL17 Salmonella typhi
B4TXB7 9.28e-86 248 96 1 128 3 rplQ Large ribosomal subunit protein bL17 Salmonella schwarzengrund (strain CVM19633)
B5BGW0 9.28e-86 248 96 1 128 3 rplQ Large ribosomal subunit protein bL17 Salmonella paratyphi A (strain AKU_12601)
C0PZV7 9.28e-86 248 96 1 128 3 rplQ Large ribosomal subunit protein bL17 Salmonella paratyphi C (strain RKS4594)
A9N8B8 9.28e-86 248 96 1 128 3 rplQ Large ribosomal subunit protein bL17 Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PK06 9.28e-86 248 96 1 128 3 rplQ Large ribosomal subunit protein bL17 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SUR5 9.28e-86 248 96 1 128 3 rplQ Large ribosomal subunit protein bL17 Salmonella newport (strain SL254)
B4TJY4 9.28e-86 248 96 1 128 3 rplQ Large ribosomal subunit protein bL17 Salmonella heidelberg (strain SL476)
B5RH41 9.28e-86 248 96 1 128 3 rplQ Large ribosomal subunit protein bL17 Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R1F1 9.28e-86 248 96 1 128 3 rplQ Large ribosomal subunit protein bL17 Salmonella enteritidis PT4 (strain P125109)
B5FJI9 9.28e-86 248 96 1 128 3 rplQ Large ribosomal subunit protein bL17 Salmonella dublin (strain CT_02021853)
Q57J57 9.28e-86 248 96 1 128 3 rplQ Large ribosomal subunit protein bL17 Salmonella choleraesuis (strain SC-B67)
B5F7S0 9.28e-86 248 96 1 128 3 rplQ Large ribosomal subunit protein bL17 Salmonella agona (strain SL483)
B7N179 9.28e-86 248 96 1 128 3 rplQ Large ribosomal subunit protein bL17 Escherichia coli O81 (strain ED1a)
A1JS00 1.33e-85 248 95 0 127 3 rplQ Large ribosomal subunit protein bL17 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q3YWW5 6.13e-85 246 95 1 128 3 rplQ Large ribosomal subunit protein bL17 Shigella sonnei (strain Ss046)
P0AG47 6.13e-85 246 95 1 128 3 rplQ Large ribosomal subunit protein bL17 Shigella flexneri
Q0T008 6.13e-85 246 95 1 128 3 rplQ Large ribosomal subunit protein bL17 Shigella flexneri serotype 5b (strain 8401)
Q32B57 6.13e-85 246 95 1 128 3 rplQ Large ribosomal subunit protein bL17 Shigella dysenteriae serotype 1 (strain Sd197)
Q31VY2 6.13e-85 246 95 1 128 3 rplQ Large ribosomal subunit protein bL17 Shigella boydii serotype 4 (strain Sb227)
B2U2R3 6.13e-85 246 95 1 128 3 rplQ Large ribosomal subunit protein bL17 Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LRR1 6.13e-85 246 95 1 128 3 rplQ Large ribosomal subunit protein bL17 Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1R638 6.13e-85 246 95 1 128 3 rplQ Large ribosomal subunit protein bL17 Escherichia coli (strain UTI89 / UPEC)
B1LGQ0 6.13e-85 246 95 1 128 3 rplQ Large ribosomal subunit protein bL17 Escherichia coli (strain SMS-3-5 / SECEC)
B6I208 6.13e-85 246 95 1 128 3 rplQ Large ribosomal subunit protein bL17 Escherichia coli (strain SE11)
B7NDR6 6.13e-85 246 95 1 128 3 rplQ Large ribosomal subunit protein bL17 Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0AG44 6.13e-85 246 95 1 128 1 rplQ Large ribosomal subunit protein bL17 Escherichia coli (strain K12)
B1IQ05 6.13e-85 246 95 1 128 3 rplQ Large ribosomal subunit protein bL17 Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0AG45 6.13e-85 246 95 1 128 3 rplQ Large ribosomal subunit protein bL17 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TCG7 6.13e-85 246 95 1 128 3 rplQ Large ribosomal subunit protein bL17 Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AGI5 6.13e-85 246 95 1 128 3 rplQ Large ribosomal subunit protein bL17 Escherichia coli O1:K1 / APEC
A8A599 6.13e-85 246 95 1 128 3 rplQ Large ribosomal subunit protein bL17 Escherichia coli O9:H4 (strain HS)
B1X6E6 6.13e-85 246 95 1 128 3 rplQ Large ribosomal subunit protein bL17 Escherichia coli (strain K12 / DH10B)
C4ZUE9 6.13e-85 246 95 1 128 3 rplQ Large ribosomal subunit protein bL17 Escherichia coli (strain K12 / MC4100 / BW2952)
B7M100 6.13e-85 246 95 1 128 3 rplQ Large ribosomal subunit protein bL17 Escherichia coli O8 (strain IAI1)
B7NLL4 6.13e-85 246 95 1 128 3 rplQ Large ribosomal subunit protein bL17 Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YT13 6.13e-85 246 95 1 128 3 rplQ Large ribosomal subunit protein bL17 Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0AG46 6.13e-85 246 95 1 128 3 rplQ Large ribosomal subunit protein bL17 Escherichia coli O157:H7
B7LHZ6 6.13e-85 246 95 1 128 3 rplQ Large ribosomal subunit protein bL17 Escherichia coli (strain 55989 / EAEC)
B7MCR0 6.13e-85 246 95 1 128 3 rplQ Large ribosomal subunit protein bL17 Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UK18 6.13e-85 246 95 1 128 3 rplQ Large ribosomal subunit protein bL17 Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZSI3 6.13e-85 246 95 1 128 3 rplQ Large ribosomal subunit protein bL17 Escherichia coli O139:H28 (strain E24377A / ETEC)
B1JJH1 6.7e-85 246 94 0 127 3 rplQ Large ribosomal subunit protein bL17 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q664U7 6.7e-85 246 94 0 127 3 rplQ Large ribosomal subunit protein bL17 Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TH16 6.7e-85 246 94 0 127 3 rplQ Large ribosomal subunit protein bL17 Yersinia pestis (strain Pestoides F)
Q1CCW9 6.7e-85 246 94 0 127 3 rplQ Large ribosomal subunit protein bL17 Yersinia pestis bv. Antiqua (strain Nepal516)
A9R919 6.7e-85 246 94 0 127 3 rplQ Large ribosomal subunit protein bL17 Yersinia pestis bv. Antiqua (strain Angola)
Q7CFS8 6.7e-85 246 94 0 127 3 rplQ Large ribosomal subunit protein bL17 Yersinia pestis
B2K511 6.7e-85 246 94 0 127 3 rplQ Large ribosomal subunit protein bL17 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C2X2 6.7e-85 246 94 0 127 3 rplQ Large ribosomal subunit protein bL17 Yersinia pestis bv. Antiqua (strain Antiqua)
A7FNK9 6.7e-85 246 94 0 127 3 rplQ Large ribosomal subunit protein bL17 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
C6DFS2 7e-85 246 94 0 127 3 rplQ Large ribosomal subunit protein bL17 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6CZZ6 7e-85 246 94 0 127 3 rplQ Large ribosomal subunit protein bL17 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q7MYH6 8.74e-84 243 95 1 127 3 rplQ Large ribosomal subunit protein bL17 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
C5BF26 6.74e-82 239 98 0 118 3 rplQ Large ribosomal subunit protein bL17 Edwardsiella ictaluri (strain 93-146)
Q2NQP8 1.74e-80 235 97 0 117 3 rplQ Large ribosomal subunit protein bL17 Sodalis glossinidius (strain morsitans)
B5FGE2 3.28e-80 234 90 0 125 3 rplQ Large ribosomal subunit protein bL17 Aliivibrio fischeri (strain MJ11)
Q5E888 3.28e-80 234 90 0 125 3 rplQ Large ribosomal subunit protein bL17 Aliivibrio fischeri (strain ATCC 700601 / ES114)
A6VLL4 1.06e-79 233 90 0 126 3 rplQ Large ribosomal subunit protein bL17 Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
A4SSY0 1.43e-79 233 94 0 118 3 rplQ Large ribosomal subunit protein bL17 Aeromonas salmonicida (strain A449)
A0KF46 1.43e-79 233 94 0 118 3 rplQ Large ribosomal subunit protein bL17 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
B6EPV0 2.47e-79 232 89 1 128 3 rplQ Large ribosomal subunit protein bL17 Aliivibrio salmonicida (strain LFI1238)
Q65QY1 1.24e-78 230 90 1 128 3 rplQ Large ribosomal subunit protein bL17 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
B8F6P5 7.25e-78 228 87 0 128 3 rplQ Large ribosomal subunit protein bL17 Glaesserella parasuis serovar 5 (strain SH0165)
B0BSV7 1.34e-77 228 89 1 128 3 rplQ Large ribosomal subunit protein bL17 Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3GZ37 1.34e-77 228 89 1 128 3 rplQ Large ribosomal subunit protein bL17 Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
P44355 1.86e-77 228 88 1 127 3 rplQ Large ribosomal subunit protein bL17 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UHV6 1.86e-77 228 88 1 127 3 rplQ Large ribosomal subunit protein bL17 Haemophilus influenzae (strain PittGG)
A5UDS1 1.86e-77 228 88 1 127 3 rplQ Large ribosomal subunit protein bL17 Haemophilus influenzae (strain PittEE)
Q4QM96 1.86e-77 228 88 1 127 3 rplQ Large ribosomal subunit protein bL17 Haemophilus influenzae (strain 86-028NP)
C3LRN2 2.74e-77 227 92 0 118 3 rplQ Large ribosomal subunit protein bL17 Vibrio cholerae serotype O1 (strain M66-2)
Q9KP09 2.74e-77 227 92 0 118 3 rplQ Large ribosomal subunit protein bL17 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F571 2.74e-77 227 92 0 118 3 rplQ Large ribosomal subunit protein bL17 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q7VKF9 5.4e-77 226 91 0 120 3 rplQ Large ribosomal subunit protein bL17 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
B0UX40 6.44e-77 226 86 0 128 3 rplQ Large ribosomal subunit protein bL17 Histophilus somni (strain 2336)
Q0I136 6.44e-77 226 86 0 128 3 rplQ Large ribosomal subunit protein bL17 Histophilus somni (strain 129Pt)
Q9CL54 9.45e-77 226 93 0 118 3 rplQ Large ribosomal subunit protein bL17 Pasteurella multocida (strain Pm70)
B7VLD1 1.3e-76 225 85 1 128 3 rplQ Large ribosomal subunit protein bL17 Vibrio atlanticus (strain LGP32)
Q87SY9 1.36e-76 225 87 0 125 3 rplQ Large ribosomal subunit protein bL17 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
C4K792 2.68e-76 224 87 0 124 3 rplQ Large ribosomal subunit protein bL17 Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
Q7MPG3 5.78e-76 224 91 0 118 3 rplQ Large ribosomal subunit protein bL17 Vibrio vulnificus (strain YJ016)
Q8DE64 5.78e-76 224 91 0 118 3 rplQ Large ribosomal subunit protein bL17 Vibrio vulnificus (strain CMCP6)
Q6LV90 2.41e-75 222 84 1 128 3 rplQ Large ribosomal subunit protein bL17 Photobacterium profundum (strain SS9)
C4L7V6 8.13e-75 221 85 1 127 3 rplQ Large ribosomal subunit protein bL17 Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q3IJI7 1.68e-74 220 83 1 128 3 rplQ Large ribosomal subunit protein bL17 Pseudoalteromonas translucida (strain TAC 125)
B4RT54 3.95e-74 219 86 0 118 3 rplQ Large ribosomal subunit protein bL17 Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
Q5QXV0 4.31e-74 219 88 0 118 3 rplQ Large ribosomal subunit protein bL17 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
A9KWC7 2.33e-73 217 85 0 121 3 rplQ Large ribosomal subunit protein bL17 Shewanella baltica (strain OS195)
A6WHV4 2.33e-73 217 85 0 121 3 rplQ Large ribosomal subunit protein bL17 Shewanella baltica (strain OS185)
A3DA46 2.33e-73 217 85 0 121 3 rplQ Large ribosomal subunit protein bL17 Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8EBH9 2.33e-73 217 85 0 121 3 rplQ Large ribosomal subunit protein bL17 Shewanella baltica (strain OS223)
Q15X47 1.47e-72 215 85 0 118 3 rplQ Large ribosomal subunit protein bL17 Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
A1REE0 2.07e-72 215 85 0 121 3 rplQ Large ribosomal subunit protein bL17 Shewanella sp. (strain W3-18-1)
A4YBV7 2.07e-72 215 85 0 121 3 rplQ Large ribosomal subunit protein bL17 Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q8EK46 2.07e-72 215 85 0 121 3 rplQ Large ribosomal subunit protein bL17 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
B1KM34 3.66e-72 214 80 0 128 3 rplQ Large ribosomal subunit protein bL17 Shewanella woodyi (strain ATCC 51908 / MS32)
A1S244 9.62e-72 213 87 0 118 3 rplQ Large ribosomal subunit protein bL17 Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
A8G1C4 2.12e-71 212 79 0 128 3 rplQ Large ribosomal subunit protein bL17 Shewanella sediminis (strain HAW-EB3)
A3Q9A8 2.94e-71 212 85 0 118 3 rplQ Large ribosomal subunit protein bL17 Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q9S0Q7 3.04e-71 212 85 0 118 3 rplQ Large ribosomal subunit protein bL17 Shewanella violacea (strain JCM 10179 / CIP 106290 / LMG 19151 / DSS12)
B8CNF9 3.08e-71 212 83 0 121 3 rplQ Large ribosomal subunit protein bL17 Shewanella piezotolerans (strain WP3 / JCM 13877)
A8GZ01 3.08e-71 212 83 0 121 3 rplQ Large ribosomal subunit protein bL17 Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
Q0I079 3.18e-71 212 86 0 118 3 rplQ Large ribosomal subunit protein bL17 Shewanella sp. (strain MR-7)
Q0HNR1 3.18e-71 212 86 0 118 3 rplQ Large ribosomal subunit protein bL17 Shewanella sp. (strain MR-4)
A0KRQ0 3.18e-71 212 86 0 118 3 rplQ Large ribosomal subunit protein bL17 Shewanella sp. (strain ANA-3)
B0TLY7 6.78e-71 211 83 0 121 3 rplQ Large ribosomal subunit protein bL17 Shewanella halifaxensis (strain HAW-EB4)
Q12ST3 1.25e-70 210 86 0 118 3 rplQ Large ribosomal subunit protein bL17 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q089M8 4.88e-70 209 85 0 118 3 rplQ Large ribosomal subunit protein bL17 Shewanella frigidimarina (strain NCIMB 400)
Q488Y7 2.1e-69 207 83 0 118 3 rplQ Large ribosomal subunit protein bL17 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q0VSH7 1.15e-68 205 82 0 120 3 rplQ Large ribosomal subunit protein bL17 Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q1R0E9 1.93e-67 202 77 1 128 3 rplQ Large ribosomal subunit protein bL17 Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
A6W366 4.49e-67 201 79 0 118 3 rplQ Large ribosomal subunit protein bL17 Marinomonas sp. (strain MWYL1)
Q3K613 7.59e-67 201 76 0 128 3 rplQ Large ribosomal subunit protein bL17 Pseudomonas fluorescens (strain Pf0-1)
C3K2V0 8.29e-67 201 75 0 128 3 rplQ Large ribosomal subunit protein bL17 Pseudomonas fluorescens (strain SBW25)
B3PK63 1.28e-66 200 75 0 128 3 rplQ Large ribosomal subunit protein bL17 Cellvibrio japonicus (strain Ueda107)
Q4ZMR9 2.83e-66 199 76 0 128 3 rplQ Large ribosomal subunit protein bL17 Pseudomonas syringae pv. syringae (strain B728a)
Q4K558 2.86e-66 199 75 0 128 3 rplQ Large ribosomal subunit protein bL17 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
C5BQ87 3.15e-66 199 76 0 125 3 rplQ Large ribosomal subunit protein bL17 Teredinibacter turnerae (strain ATCC 39867 / T7901)
Q889U5 8.02e-66 198 75 0 128 3 rplQ Large ribosomal subunit protein bL17 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q48D62 1.23e-65 197 75 0 128 3 rplQ Large ribosomal subunit protein bL17 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
B2FQK9 3.81e-65 196 73 0 126 3 rplQ Large ribosomal subunit protein bL17 Stenotrophomonas maltophilia (strain K279a)
B4SLH6 4.59e-65 196 74 1 128 3 rplQ Large ribosomal subunit protein bL17 Stenotrophomonas maltophilia (strain R551-3)
B1JAI6 4.95e-65 196 75 0 128 3 rplQ Large ribosomal subunit protein bL17 Pseudomonas putida (strain W619)
Q88QL0 4.95e-65 196 75 0 128 3 rplQ Large ribosomal subunit protein bL17 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KK92 4.95e-65 196 75 0 128 3 rplQ Large ribosomal subunit protein bL17 Pseudomonas putida (strain GB-1)
A5VXS3 4.95e-65 196 75 0 128 3 rplQ Large ribosomal subunit protein bL17 Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q1IFU0 4.95e-65 196 75 0 128 3 rplQ Large ribosomal subunit protein bL17 Pseudomonas entomophila (strain L48)
Q1LTB2 4.95e-65 196 75 0 123 3 rplQ Large ribosomal subunit protein bL17 Baumannia cicadellinicola subsp. Homalodisca coagulata
Q1H4L1 7.58e-65 196 75 0 125 3 rplQ Large ribosomal subunit protein bL17 Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q21M32 8.37e-65 196 77 0 118 3 rplQ Large ribosomal subunit protein bL17 Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
A4VHQ6 9.88e-65 195 75 1 129 3 rplQ Large ribosomal subunit protein bL17 Stutzerimonas stutzeri (strain A1501)
A4XZ64 1.06e-64 195 75 0 128 3 rplQ Large ribosomal subunit protein bL17 Pseudomonas mendocina (strain ymp)
B2SRE3 2.33e-64 194 73 0 126 3 rplQ Large ribosomal subunit protein bL17 Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2P010 2.33e-64 194 73 0 126 3 rplQ Large ribosomal subunit protein bL17 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q8PNQ7 2.33e-64 194 73 0 126 3 rplQ Large ribosomal subunit protein bL17 Xanthomonas axonopodis pv. citri (strain 306)
A1TYM3 2.89e-64 194 77 0 118 3 rplQ Large ribosomal subunit protein bL17 Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q0ABE9 4.18e-64 194 76 0 118 3 rplQ Large ribosomal subunit protein bL17 Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q9Z3E6 4.49e-64 194 77 0 118 3 rplQ Large ribosomal subunit protein bL17 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RU57 4.49e-64 194 77 0 118 3 rplQ Large ribosomal subunit protein bL17 Xanthomonas campestris pv. campestris (strain B100)
Q4URG4 4.49e-64 194 77 0 118 3 rplQ Large ribosomal subunit protein bL17 Xanthomonas campestris pv. campestris (strain 8004)
Q3BWV8 3.3e-63 191 73 0 126 3 rplQ Large ribosomal subunit protein bL17 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
O52761 4.34e-63 191 77 0 118 1 rplQ Large ribosomal subunit protein bL17 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02T54 4.34e-63 191 77 0 118 3 rplQ Large ribosomal subunit protein bL17 Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V669 4.34e-63 191 77 0 118 3 rplQ Large ribosomal subunit protein bL17 Pseudomonas aeruginosa (strain LESB58)
A6UZL4 4.34e-63 191 77 0 118 3 rplQ Large ribosomal subunit protein bL17 Pseudomonas aeruginosa (strain PA7)
Q5GWW0 5.18e-63 191 73 0 126 3 rplQ Large ribosomal subunit protein bL17 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
C1DKN9 5.34e-63 191 77 0 118 3 rplQ Large ribosomal subunit protein bL17 Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q31IV7 7.51e-63 191 72 0 123 3 rplQ Large ribosomal subunit protein bL17 Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
B2UEJ2 9.43e-63 190 71 1 132 3 rplQ Large ribosomal subunit protein bL17 Ralstonia pickettii (strain 12J)
B8GV32 1.1e-62 190 71 0 127 3 rplQ Large ribosomal subunit protein bL17 Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
A1KB00 2.12e-62 189 73 0 123 3 rplQ Large ribosomal subunit protein bL17 Azoarcus sp. (strain BH72)
Q2S938 5.23e-62 188 68 0 128 3 rplQ Large ribosomal subunit protein bL17 Hahella chejuensis (strain KCTC 2396)
Q1LI64 5.4e-62 188 75 0 120 3 rplQ Large ribosomal subunit protein bL17 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q605D8 8.26e-62 187 74 0 118 3 rplQ Large ribosomal subunit protein bL17 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
A1W334 9.24e-62 188 71 0 128 3 rplQ Large ribosomal subunit protein bL17 Acidovorax sp. (strain JS42)
B9MBW3 9.24e-62 188 71 0 128 3 rplQ Large ribosomal subunit protein bL17 Acidovorax ebreus (strain TPSY)
Q5P306 9.32e-62 188 73 0 126 3 rplQ Large ribosomal subunit protein bL17 Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
B8D823 1.22e-61 187 69 0 124 3 rplQ Large ribosomal subunit protein bL17 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
B8D9S1 1.22e-61 187 69 0 124 3 rplQ Large ribosomal subunit protein bL17 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
B3R7E2 1.74e-61 187 75 0 120 3 rplQ Large ribosomal subunit protein bL17 Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q0K646 1.74e-61 187 75 0 120 3 rplQ Large ribosomal subunit protein bL17 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
C1DAU4 2.11e-61 187 74 1 128 3 rplQ Large ribosomal subunit protein bL17 Laribacter hongkongensis (strain HLHK9)
P57565 2.73e-61 187 69 0 124 3 rplQ Large ribosomal subunit protein bL17 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
A4G9R2 4.43e-61 186 71 1 128 3 rplQ Large ribosomal subunit protein bL17 Herminiimonas arsenicoxydans
Q46WH0 6.15e-61 186 75 0 120 3 rplQ Large ribosomal subunit protein bL17 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q83EQ1 9.68e-61 185 72 0 123 3 rplQ Large ribosomal subunit protein bL17 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NAZ6 9.68e-61 185 72 0 123 3 rplQ Large ribosomal subunit protein bL17 Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KD05 9.68e-61 185 72 0 123 3 rplQ Large ribosomal subunit protein bL17 Coxiella burnetii (strain Dugway 5J108-111)
B6J237 9.68e-61 185 72 0 123 3 rplQ Large ribosomal subunit protein bL17 Coxiella burnetii (strain CbuG_Q212)
Q8XV39 1.32e-60 185 75 0 118 3 rplQ Large ribosomal subunit protein bL17 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
A6T3H7 2.01e-60 184 70 1 128 3 rplQ Large ribosomal subunit protein bL17 Janthinobacterium sp. (strain Marseille)
Q3J8T9 2.83e-60 184 72 1 126 3 rplQ Large ribosomal subunit protein bL17 Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
B6J5F8 3.65e-60 184 71 0 123 3 rplQ Large ribosomal subunit protein bL17 Coxiella burnetii (strain CbuK_Q154)
Q2L235 7.91e-60 183 70 1 131 3 rplQ Large ribosomal subunit protein bL17 Bordetella avium (strain 197N)
Q3SLM3 9.97e-60 182 71 0 122 3 rplQ Large ribosomal subunit protein bL17 Thiobacillus denitrificans (strain ATCC 25259)
B0V6U8 2.09e-59 182 72 1 125 3 rplQ Large ribosomal subunit protein bL17 Acinetobacter baumannii (strain AYE)
A3M958 2.09e-59 182 72 1 125 3 rplQ Large ribosomal subunit protein bL17 Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B0VQU4 2.09e-59 182 72 1 125 3 rplQ Large ribosomal subunit protein bL17 Acinetobacter baumannii (strain SDF)
B7GW28 2.09e-59 182 72 1 125 3 rplQ Large ribosomal subunit protein bL17 Acinetobacter baumannii (strain AB307-0294)
B7IA13 3.2e-59 181 72 1 125 1 rplQ Large ribosomal subunit protein bL17 Acinetobacter baumannii (strain AB0057)
A4SUY7 3.48e-59 181 70 0 127 3 rplQ Large ribosomal subunit protein bL17 Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
A5EXB2 4.91e-59 181 71 1 119 3 rplQ Large ribosomal subunit protein bL17 Dichelobacter nodosus (strain VCS1703A)
A2SLD0 4.99e-59 181 73 0 118 3 rplQ Large ribosomal subunit protein bL17 Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
Q6F7T8 7.12e-59 180 71 1 125 3 rplQ Large ribosomal subunit protein bL17 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q21QQ0 8.81e-59 180 73 0 120 3 rplQ Large ribosomal subunit protein bL17 Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q493I3 9.16e-59 180 66 0 120 3 rplQ Large ribosomal subunit protein bL17 Blochmanniella pennsylvanica (strain BPEN)
A9ADM0 9.21e-59 180 69 1 129 3 rplQ Large ribosomal subunit protein bL17 Burkholderia multivorans (strain ATCC 17616 / 249)
Q7NQH8 9.84e-59 180 72 0 121 3 rplQ Large ribosomal subunit protein bL17 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q2SU54 1.06e-58 180 69 1 129 3 rplQ Large ribosomal subunit protein bL17 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q63Q38 1.06e-58 180 69 1 129 3 rplQ Large ribosomal subunit protein bL17 Burkholderia pseudomallei (strain K96243)
A3NEF2 1.06e-58 180 69 1 129 3 rplQ Large ribosomal subunit protein bL17 Burkholderia pseudomallei (strain 668)
Q3JMU0 1.06e-58 180 69 1 129 3 rplQ Large ribosomal subunit protein bL17 Burkholderia pseudomallei (strain 1710b)
A3P086 1.06e-58 180 69 1 129 3 rplQ Large ribosomal subunit protein bL17 Burkholderia pseudomallei (strain 1106a)
A1V876 1.06e-58 180 69 1 129 3 rplQ Large ribosomal subunit protein bL17 Burkholderia mallei (strain SAVP1)
Q62GN2 1.06e-58 180 69 1 129 3 rplQ Large ribosomal subunit protein bL17 Burkholderia mallei (strain ATCC 23344)
A2S7K3 1.06e-58 180 69 1 129 3 rplQ Large ribosomal subunit protein bL17 Burkholderia mallei (strain NCTC 10229)
Q47J76 1.17e-58 180 66 1 132 3 rplQ Large ribosomal subunit protein bL17 Dechloromonas aromatica (strain RCB)
Q1QDG0 1.19e-58 179 71 0 118 3 rplQ Large ribosomal subunit protein bL17 Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q4FUD0 1.19e-58 179 71 0 118 3 rplQ Large ribosomal subunit protein bL17 Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
A9IHR4 1.41e-58 180 72 1 126 3 rplQ Large ribosomal subunit protein bL17 Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
A4JAR7 1.72e-58 179 68 1 129 3 rplQ Large ribosomal subunit protein bL17 Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q1BRX5 1.72e-58 179 68 1 129 3 rplQ Large ribosomal subunit protein bL17 Burkholderia orbicola (strain AU 1054)
B1JU49 1.72e-58 179 68 1 129 3 rplQ Large ribosomal subunit protein bL17 Burkholderia orbicola (strain MC0-3)
Q39KE0 1.72e-58 179 68 1 129 3 rplQ Large ribosomal subunit protein bL17 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q0BJ19 1.72e-58 179 68 1 129 3 rplQ Large ribosomal subunit protein bL17 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B4E5E7 1.72e-58 179 68 1 129 3 rplQ Large ribosomal subunit protein bL17 Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A0K3Q2 1.72e-58 179 68 1 129 3 rplQ Large ribosomal subunit protein bL17 Burkholderia cenocepacia (strain HI2424)
B1YRQ6 1.72e-58 179 68 1 129 3 rplQ Large ribosomal subunit protein bL17 Burkholderia ambifaria (strain MC40-6)
Q8K973 1.85e-58 180 69 0 119 3 rplQ Large ribosomal subunit protein bL17 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
A1WV96 2.59e-58 179 68 0 121 3 rplQ Large ribosomal subunit protein bL17 Halorhodospira halophila (strain DSM 244 / SL1)
A9BRX6 4.28e-58 179 73 0 116 3 rplQ Large ribosomal subunit protein bL17 Delftia acidovorans (strain DSM 14801 / SPH-1)
Q7VTA6 5.32e-58 178 67 1 131 3 rplQ Large ribosomal subunit protein bL17 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W2D0 5.32e-58 178 67 1 131 3 rplQ Large ribosomal subunit protein bL17 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WR98 5.32e-58 178 67 1 131 3 rplQ Large ribosomal subunit protein bL17 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q2YAX1 1.43e-57 177 66 1 130 3 rplQ Large ribosomal subunit protein bL17 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
C5CQ74 1.77e-57 177 70 0 120 3 rplQ Large ribosomal subunit protein bL17 Variovorax paradoxus (strain S110)
Q12G76 1.81e-57 177 68 0 126 3 rplQ Large ribosomal subunit protein bL17 Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q9PE51 3.3e-57 176 68 0 118 3 rplQ Large ribosomal subunit protein bL17 Xylella fastidiosa (strain 9a5c)
Q0AIH0 3.43e-57 176 66 0 124 3 rplQ Large ribosomal subunit protein bL17 Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
A5WCL5 3.43e-57 176 71 0 118 3 rplQ Large ribosomal subunit protein bL17 Psychrobacter sp. (strain PRwf-1)
A1AVM6 3.91e-57 176 69 1 128 3 rplQ Large ribosomal subunit protein bL17 Ruthia magnifica subsp. Calyptogena magnifica
B0U5M4 4.95e-57 176 68 0 118 3 rplQ Large ribosomal subunit protein bL17 Xylella fastidiosa (strain M12)
A1KRK0 5.3e-57 176 68 0 122 3 rplQ Large ribosomal subunit protein bL17 Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q9JX16 5.3e-57 176 68 0 122 3 rplQ Large ribosomal subunit protein bL17 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
B1XSS8 6.84e-57 176 72 0 118 3 rplQ Large ribosomal subunit protein bL17 Polynucleobacter necessarius subsp. necessarius (strain STIR1)
A1WK91 7.61e-57 176 70 0 124 3 rplQ Large ribosomal subunit protein bL17 Verminephrobacter eiseniae (strain EF01-2)
A1VJ41 7.87e-57 176 68 0 124 3 rplQ Large ribosomal subunit protein bL17 Polaromonas naphthalenivorans (strain CJ2)
Q9K1I1 7.96e-57 175 68 0 122 3 rplQ Large ribosomal subunit protein bL17 Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
A9M3T9 7.96e-57 175 68 0 122 3 rplQ Large ribosomal subunit protein bL17 Neisseria meningitidis serogroup C (strain 053442)
B2JI38 9.5e-57 175 72 0 118 3 rplQ Large ribosomal subunit protein bL17 Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q5F5V3 3.24e-56 174 68 0 122 3 rplQ Large ribosomal subunit protein bL17 Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q89A88 3.36e-56 174 63 0 124 3 rplQ Large ribosomal subunit protein bL17 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q87E59 5.11e-56 173 67 0 118 3 rplQ Large ribosomal subunit protein bL17 Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I8J4 5.11e-56 173 67 0 118 3 rplQ Large ribosomal subunit protein bL17 Xylella fastidiosa (strain M23)
Q82X68 9.49e-56 172 68 0 121 3 rplQ Large ribosomal subunit protein bL17 Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q13TJ7 9.7e-56 172 70 0 118 3 rplQ Large ribosomal subunit protein bL17 Paraburkholderia xenovorans (strain LB400)
B2T724 9.7e-56 172 70 0 118 3 rplQ Large ribosomal subunit protein bL17 Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
B5EMA0 1.09e-55 172 69 1 126 3 rplQ Large ribosomal subunit protein bL17 Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J4A5 1.09e-55 172 69 1 126 3 rplQ Large ribosomal subunit protein bL17 Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
Q5ZYL7 1.65e-55 172 63 0 124 3 rplQ Large ribosomal subunit protein bL17 Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A5IHP0 1.65e-55 172 63 0 124 3 rplQ Large ribosomal subunit protein bL17 Legionella pneumophila (strain Corby)
Q5X833 2.1e-55 172 63 0 124 3 rplQ Large ribosomal subunit protein bL17 Legionella pneumophila (strain Paris)
A1TJU3 4.01e-55 171 68 0 120 3 rplQ Large ribosomal subunit protein bL17 Paracidovorax citrulli (strain AAC00-1)
A5CXJ0 4.25e-55 171 70 0 117 3 rplQ Large ribosomal subunit protein bL17 Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
Q5WZI6 5.32e-55 171 66 0 118 3 rplQ Large ribosomal subunit protein bL17 Legionella pneumophila (strain Lens)
B1Y7M8 5.58e-54 168 66 1 128 3 rplQ Large ribosomal subunit protein bL17 Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
A4IZQ8 4.57e-52 164 58 2 145 3 rplQ Large ribosomal subunit protein bL17 Francisella tularensis subsp. tularensis (strain WY96-3418)
Q0BNQ2 4.57e-52 164 58 2 145 3 rplQ Large ribosomal subunit protein bL17 Francisella tularensis subsp. holarctica (strain OSU18)
A0Q4K9 4.57e-52 164 58 2 145 3 rplQ Large ribosomal subunit protein bL17 Francisella tularensis subsp. novicida (strain U112)
B2SDV9 4.57e-52 164 58 2 145 3 rplQ Large ribosomal subunit protein bL17 Francisella tularensis subsp. mediasiatica (strain FSC147)
Q2A5E4 4.57e-52 164 58 2 145 3 rplQ Large ribosomal subunit protein bL17 Francisella tularensis subsp. holarctica (strain LVS)
A7N9V0 4.57e-52 164 58 2 145 3 rplQ Large ribosomal subunit protein bL17 Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
Q5NHU2 6.28e-52 164 58 2 145 3 rplQ Large ribosomal subunit protein bL17 Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q14J94 6.28e-52 164 58 2 145 3 rplQ Large ribosomal subunit protein bL17 Francisella tularensis subsp. tularensis (strain FSC 198)
B0U0W4 3.39e-51 162 57 2 145 3 rplQ Large ribosomal subunit protein bL17 Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
Q2RQY5 4.3e-51 161 66 0 118 3 rplQ Large ribosomal subunit protein bL17 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q8D1Y7 3.42e-50 158 58 0 117 3 rplQ Large ribosomal subunit protein bL17 Wigglesworthia glossinidia brevipalpis
B1Z767 1.24e-48 155 61 0 118 3 rplQ Large ribosomal subunit protein bL17 Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
B7L0S4 1.38e-48 155 61 0 118 3 rplQ Large ribosomal subunit protein bL17 Methylorubrum extorquens (strain CM4 / NCIMB 13688)
B6IRT1 2.11e-48 154 58 1 131 3 rplQ Large ribosomal subunit protein bL17 Rhodospirillum centenum (strain ATCC 51521 / SW)
Q7VQC2 2.16e-48 154 59 0 120 3 rplQ Large ribosomal subunit protein bL17 Blochmanniella floridana
A9W4R4 2.28e-48 154 61 0 118 3 rplQ Large ribosomal subunit protein bL17 Methylorubrum extorquens (strain PA1)
A1USR9 1.06e-47 152 62 0 118 3 rplQ Large ribosomal subunit protein bL17 Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
B1LWP8 1.08e-47 152 61 0 118 3 rplQ Large ribosomal subunit protein bL17 Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
A9IVZ4 2.09e-47 152 63 0 118 3 rplQ Large ribosomal subunit protein bL17 Bartonella tribocorum (strain CIP 105476 / IBS 506)
Q5FU08 5.43e-47 151 63 0 118 3 rplQ Large ribosomal subunit protein bL17 Gluconobacter oxydans (strain 621H)
Q6FZE7 6.51e-47 150 63 0 118 3 rplQ Large ribosomal subunit protein bL17 Bartonella quintana (strain Toulouse)
Q6G2Z0 1.36e-46 150 63 0 118 3 rplQ Large ribosomal subunit protein bL17 Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
A7HWT6 2.46e-46 149 61 0 121 3 rplQ Large ribosomal subunit protein bL17 Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
Q2W2L4 1.05e-45 147 60 0 118 3 rplQ Large ribosomal subunit protein bL17 Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q07KP3 1.06e-45 147 61 0 118 3 rplQ Large ribosomal subunit protein bL17 Rhodopseudomonas palustris (strain BisA53)
Q11HS7 1.18e-45 147 60 0 126 3 rplQ Large ribosomal subunit protein bL17 Chelativorans sp. (strain BNC1)
B9KLB6 1.62e-45 147 59 0 126 3 rplQ Large ribosomal subunit protein bL17 Cereibacter sphaeroides (strain KD131 / KCTC 12085)
Q3J5P7 1.62e-45 147 59 0 126 3 rplQ Large ribosomal subunit protein bL17 Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A3PGN6 1.62e-45 147 59 0 126 3 rplQ Large ribosomal subunit protein bL17 Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
Q1GK03 1.65e-45 147 58 0 126 3 rplQ Large ribosomal subunit protein bL17 Ruegeria sp. (strain TM1040)
A8LM82 1.73e-45 147 61 0 118 3 rplQ Large ribosomal subunit protein bL17 Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
B8H4G0 1.83e-45 147 59 0 122 3 rplQ Large ribosomal subunit protein bL17 Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A8S8 1.83e-45 147 59 0 122 3 rplQ Large ribosomal subunit protein bL17 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q0ANS5 1.84e-45 147 59 0 126 3 rplQ Large ribosomal subunit protein bL17 Maricaulis maris (strain MCS10)
Q2N9D8 2.19e-45 147 58 0 121 3 rplQ Large ribosomal subunit protein bL17 Erythrobacter litoralis (strain HTCC2594)
Q3SSU1 2.74e-45 146 60 0 118 3 rplQ Large ribosomal subunit protein bL17 Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
B8IT36 4.77e-45 146 55 1 140 3 rplQ Large ribosomal subunit protein bL17 Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
A8EZJ1 5.02e-45 145 59 0 118 3 rplQ Large ribosomal subunit protein bL17 Rickettsia canadensis (strain McKiel)
A6U884 5.73e-45 145 59 0 118 3 rplQ Large ribosomal subunit protein bL17 Sinorhizobium medicae (strain WSM419)
Q926A5 9.9e-45 145 58 0 118 3 rplQ Large ribosomal subunit protein bL17 Rhizobium meliloti (strain 1021)
B6JEX2 1.08e-44 145 60 0 118 3 rplQ Large ribosomal subunit protein bL17 Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
C3MB04 1.37e-44 145 58 0 118 3 rplQ Large ribosomal subunit protein bL17 Sinorhizobium fredii (strain NBRC 101917 / NGR234)
B0UHU4 1.54e-44 144 55 1 135 3 rplQ Large ribosomal subunit protein bL17 Methylobacterium sp. (strain 4-46)
Q1QN05 1.72e-44 144 60 0 118 3 rplQ Large ribosomal subunit protein bL17 Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q211H3 1.75e-44 144 58 0 121 3 rplQ Large ribosomal subunit protein bL17 Rhodopseudomonas palustris (strain BisB18)
Q4UMQ4 2.04e-44 144 60 0 118 3 rplQ Large ribosomal subunit protein bL17 Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q16AB7 2.06e-44 144 56 0 126 3 rplQ Large ribosomal subunit protein bL17 Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
B9JDV3 2.71e-44 144 56 0 126 3 rplQ Large ribosomal subunit protein bL17 Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
B3PWU6 2.99e-44 144 55 1 128 3 rplQ Large ribosomal subunit protein bL17 Rhizobium etli (strain CIAT 652)
A4WVI3 3.13e-44 144 57 0 126 3 rplQ Large ribosomal subunit protein bL17 Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
Q28US7 3.43e-44 144 59 0 118 3 rplQ Large ribosomal subunit protein bL17 Jannaschia sp. (strain CCS1)
Q2K9J1 4.11e-44 144 55 1 128 3 rplQ Large ribosomal subunit protein bL17 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q1MIB6 4.44e-44 143 55 1 128 3 rplQ Large ribosomal subunit protein bL17 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q0BUM5 5.8e-44 143 61 0 118 3 rplQ Large ribosomal subunit protein bL17 Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
Q9ZCT0 6.02e-44 143 61 0 118 3 rplQ Large ribosomal subunit protein bL17 Rickettsia prowazekii (strain Madrid E)
Q0BYD9 6.87e-44 143 54 0 126 3 rplQ Large ribosomal subunit protein bL17 Hyphomonas neptunium (strain ATCC 15444)
A8GT44 6.93e-44 143 60 0 118 3 rplQ Large ribosomal subunit protein bL17 Rickettsia rickettsii (strain Sheila Smith)
B0BUN5 6.93e-44 143 60 0 118 3 rplQ Large ribosomal subunit protein bL17 Rickettsia rickettsii (strain Iowa)
C4K2F4 6.93e-44 143 60 0 118 3 rplQ Large ribosomal subunit protein bL17 Rickettsia peacockii (strain Rustic)
A8F2C2 7.91e-44 142 59 0 118 3 rplQ Large ribosomal subunit protein bL17 Rickettsia massiliae (strain Mtu5)
Q92GZ1 8.44e-44 142 60 0 118 3 rplQ Large ribosomal subunit protein bL17 Rickettsia conorii (strain ATCC VR-613 / Malish 7)
B5ZZ58 9.75e-44 142 57 0 118 3 rplQ Large ribosomal subunit protein bL17 Rhizobium leguminosarum bv. trifolii (strain WSM2304)
B4R8P2 9.9e-44 142 60 0 118 3 rplQ Large ribosomal subunit protein bL17 Phenylobacterium zucineum (strain HLK1)
Q1RHP6 1.38e-43 142 58 0 118 3 rplQ Large ribosomal subunit protein bL17 Rickettsia bellii (strain RML369-C)
A8GVD8 1.38e-43 142 58 0 118 3 rplQ Large ribosomal subunit protein bL17 Rickettsia bellii (strain OSU 85-389)
B9JVR2 1.41e-43 142 57 0 118 3 rplQ Large ribosomal subunit protein bL17 Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
Q1GVN7 1.45e-43 142 59 0 118 3 rplQ Large ribosomal subunit protein bL17 Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
B0T2E7 1.5e-43 142 58 0 121 3 rplQ Large ribosomal subunit protein bL17 Caulobacter sp. (strain K31)
B3CT30 1.58e-43 142 59 0 118 3 rplQ Large ribosomal subunit protein bL17 Orientia tsutsugamushi (strain Ikeda)
A4YSL7 1.64e-43 142 60 0 118 3 rplQ Large ribosomal subunit protein bL17 Bradyrhizobium sp. (strain ORS 278)
A5CCI8 1.76e-43 142 59 0 118 3 rplQ Large ribosomal subunit protein bL17 Orientia tsutsugamushi (strain Boryong)
Q134V4 1.88e-43 142 57 0 121 3 rplQ Large ribosomal subunit protein bL17 Rhodopseudomonas palustris (strain BisB5)
Q2IXN5 2.62e-43 141 57 0 121 3 rplQ Large ribosomal subunit protein bL17 Rhodopseudomonas palustris (strain HaA2)
B3QB18 2.82e-43 141 57 0 121 3 rplQ Large ribosomal subunit protein bL17 Rhodopseudomonas palustris (strain TIE-1)
Q6N4V8 2.82e-43 141 57 0 121 1 rplQ Large ribosomal subunit protein bL17 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
A1B053 3.01e-43 141 58 0 126 3 rplQ Large ribosomal subunit protein bL17 Paracoccus denitrificans (strain Pd 1222)
A5V5X4 3.5e-43 141 60 0 118 3 rplQ Large ribosomal subunit protein bL17 Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
A6X0E3 3.6e-43 141 58 0 118 3 rplQ Large ribosomal subunit protein bL17 Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
A9H3I6 3.69e-43 141 57 2 136 3 rplQ Large ribosomal subunit protein bL17 Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
Q68WA3 4.2e-43 141 58 0 118 3 rplQ Large ribosomal subunit protein bL17 Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q8G095 4.69e-43 141 58 0 118 3 rplQ Large ribosomal subunit protein bL17 Brucella suis biovar 1 (strain 1330)
B0CH06 4.69e-43 141 58 0 118 3 rplQ Large ribosomal subunit protein bL17 Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VQY1 4.69e-43 141 58 0 118 3 rplQ Large ribosomal subunit protein bL17 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
A9M5M4 4.69e-43 141 58 0 118 3 rplQ Large ribosomal subunit protein bL17 Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
A5ELK2 4.95e-43 140 59 0 118 3 rplQ Large ribosomal subunit protein bL17 Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
A5FZU0 8.19e-43 140 61 0 118 3 rplQ Large ribosomal subunit protein bL17 Acidiphilium cryptum (strain JF-5)
C3PP82 8.67e-43 140 59 0 118 3 rplQ Large ribosomal subunit protein bL17 Rickettsia africae (strain ESF-5)
Q8YHL5 9.23e-43 140 58 0 118 3 rplQ Large ribosomal subunit protein bL17 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RJH5 9.23e-43 140 58 0 118 3 rplQ Large ribosomal subunit protein bL17 Brucella melitensis biotype 2 (strain ATCC 23457)
Q57CT3 9.23e-43 140 58 0 118 3 rplQ Large ribosomal subunit protein bL17 Brucella abortus biovar 1 (strain 9-941)
Q2YRU1 9.23e-43 140 58 0 118 3 rplQ Large ribosomal subunit protein bL17 Brucella abortus (strain 2308)
B2S654 9.23e-43 140 58 0 118 3 rplQ Large ribosomal subunit protein bL17 Brucella abortus (strain S19)
Q2G5B1 9.25e-43 140 57 0 121 3 rplQ Large ribosomal subunit protein bL17 Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
Q89JA8 1.29e-42 140 58 0 118 3 rplQ Large ribosomal subunit protein bL17 Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q5LW31 1.53e-42 139 60 0 118 3 rplQ Large ribosomal subunit protein bL17 Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
A0LIL8 4.91e-42 139 56 0 120 3 rplQ Large ribosomal subunit protein bL17 Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
A7IPP5 1.32e-41 137 57 0 118 3 rplQ Large ribosomal subunit protein bL17 Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
B8EIT6 2.67e-41 136 56 0 118 3 rplQ Large ribosomal subunit protein bL17 Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
Q5NQ39 2.97e-41 136 58 0 118 3 rplQ Large ribosomal subunit protein bL17 Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q8UE41 5.39e-41 135 55 0 118 3 rplQ Large ribosomal subunit protein bL17 Agrobacterium fabrum (strain C58 / ATCC 33970)
C0Q9U6 9.31e-41 134 56 0 116 3 rplQ Large ribosomal subunit protein bL17 Desulforapulum autotrophicum (strain ATCC 43914 / DSM 3382 / VKM B-1955 / HRM2)
B2IF97 1.06e-40 135 55 0 118 3 rplQ Large ribosomal subunit protein bL17 Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
C4XLK4 1.28e-40 135 58 1 120 3 rplQ Large ribosomal subunit protein bL17 Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
A7HBP6 2.89e-40 135 56 0 118 3 rplQ Large ribosomal subunit protein bL17 Anaeromyxobacter sp. (strain Fw109-5)
Q1D747 8.89e-40 132 51 1 131 3 rplQ Large ribosomal subunit protein bL17 Myxococcus xanthus (strain DK1622)
A8IAN3 9.5e-40 132 55 0 118 3 rplQ Large ribosomal subunit protein bL17 Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
A1ALW8 1.35e-39 132 55 0 117 3 rplQ Large ribosomal subunit protein bL17 Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
B4UBC7 1.58e-39 132 56 0 118 3 rplQ Large ribosomal subunit protein bL17 Anaeromyxobacter sp. (strain K)
B8J888 2.59e-39 132 56 0 118 3 rplQ Large ribosomal subunit protein bL17 Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
Q30Z69 3.04e-39 132 59 1 116 3 rplQ Large ribosomal subunit protein bL17 Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q2IJ58 3.07e-39 132 56 0 118 3 rplQ Large ribosomal subunit protein bL17 Anaeromyxobacter dehalogenans (strain 2CP-C)
Q6AP42 3.32e-39 130 54 0 128 3 rplQ Large ribosomal subunit protein bL17 Desulfotalea psychrophila (strain LSv54 / DSM 12343)
Q2LQC8 5.37e-39 130 54 0 116 3 rplQ Large ribosomal subunit protein bL17 Syntrophus aciditrophicus (strain SB)
C6E4M9 6.59e-39 131 53 0 117 3 rplQ Large ribosomal subunit protein bL17 Geobacter sp. (strain M21)
Q8RE45 8.07e-39 129 53 0 116 3 rplQ Large ribosomal subunit protein bL17 Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q98N32 2.63e-38 129 51 0 126 3 rplQ Large ribosomal subunit protein bL17 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q3A6L9 3.82e-38 129 55 0 117 3 rplQ Large ribosomal subunit protein bL17 Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
A5GAU7 5.29e-38 129 52 0 117 3 rplQ Large ribosomal subunit protein bL17 Geotalea uraniireducens (strain Rf4)
Q39XX8 5.67e-38 129 52 0 117 3 rplQ Large ribosomal subunit protein bL17 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
A0L5Z9 1.41e-37 126 55 1 119 3 rplQ Large ribosomal subunit protein bL17 Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
Q1MPP0 2.13e-37 126 54 1 117 3 rplQ Large ribosomal subunit protein bL17 Lawsonia intracellularis (strain PHE/MN1-00)
B8DNL0 5.46e-37 125 50 2 129 3 rplQ Large ribosomal subunit protein bL17 Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
Q3YRN3 5.47e-37 125 50 1 128 3 rplQ Large ribosomal subunit protein bL17 Ehrlichia canis (strain Jake)
Q11QD9 7.16e-37 125 52 0 121 3 rplQ Large ribosomal subunit protein bL17 Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)
A6KYG9 7.56e-37 126 50 0 121 3 rplQ Large ribosomal subunit protein bL17 Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
B3E858 7.61e-37 124 53 0 122 3 rplQ Large ribosomal subunit protein bL17 Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
B9M6F1 1.02e-36 126 52 0 117 3 rplQ Large ribosomal subunit protein bL17 Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
Q64NN6 1.11e-36 125 50 0 121 3 rplQ Large ribosomal subunit protein bL17 Bacteroides fragilis (strain YCH46)
Q5L8D7 1.11e-36 125 50 0 121 3 rplQ Large ribosomal subunit protein bL17 Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
Q8A4A3 1.27e-36 125 50 0 121 3 rplQ Large ribosomal subunit protein bL17 Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q749B4 1.81e-36 125 52 0 117 3 rplQ Large ribosomal subunit protein bL17 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q2GH32 2.02e-36 124 48 1 129 3 rplQ Large ribosomal subunit protein bL17 Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas)
B8IYL8 3.05e-36 124 54 1 122 3 rplQ Large ribosomal subunit protein bL17 Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)
B8D0T8 1.36e-35 121 52 0 113 3 rplQ Large ribosomal subunit protein bL17 Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562)
Q9Z9H5 1.37e-35 121 54 1 118 1 rplQ Large ribosomal subunit protein bL17 Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q72I33 1.37e-35 121 54 1 118 1 rplQ Large ribosomal subunit protein bL17 Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
A0M572 1.48e-35 123 49 0 121 3 rplQ Large ribosomal subunit protein bL17 Christiangramia forsetii (strain DSM 17595 / CGMCC 1.15422 / KT0803)
Q2GL35 2.03e-35 121 56 2 123 3 rplQ Large ribosomal subunit protein bL17 Anaplasma phagocytophilum (strain HZ)
B9KJ46 4.19e-35 120 51 2 133 3 rplQ Large ribosomal subunit protein bL17 Anaplasma marginale (strain Florida)
A6LEG4 4.23e-35 121 48 0 127 3 rplQ Large ribosomal subunit protein bL17 Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
A8ZV83 7.12e-35 122 55 0 116 3 rplQ Large ribosomal subunit protein bL17 Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)
Q7MTP1 7.81e-35 120 47 0 128 3 rplQ Large ribosomal subunit protein bL17 Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
B2RLW4 7.81e-35 120 47 0 128 3 rplQ Large ribosomal subunit protein bL17 Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)
Q5HAU6 1.01e-34 119 50 1 122 3 rplQ Large ribosomal subunit protein bL17 Ehrlichia ruminantium (strain Welgevonden)
Q5FFS2 1.01e-34 119 50 1 122 3 rplQ Large ribosomal subunit protein bL17 Ehrlichia ruminantium (strain Gardel)
C1A4I9 1.01e-34 119 56 0 116 3 rplQ Large ribosomal subunit protein bL17 Gemmatimonas aurantiaca (strain DSM 14586 / JCM 11422 / NBRC 100505 / T-27)
B2A4Q1 1.09e-34 119 48 0 113 3 rplQ Large ribosomal subunit protein bL17 Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
A7ZFY6 1.25e-34 119 51 0 116 3 rplQ Large ribosomal subunit protein bL17 Campylobacter concisus (strain 13826)
Q2RFS7 1.27e-34 119 50 0 112 3 rplQ Large ribosomal subunit protein bL17 Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
B5YG21 1.32e-34 119 45 0 119 3 rplQ Large ribosomal subunit protein bL17 Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
Q1IS92 1.33e-34 120 51 0 116 3 rplQ Large ribosomal subunit protein bL17 Koribacter versatilis (strain Ellin345)
Q4FLP2 1.37e-34 119 47 0 118 3 rplQ Large ribosomal subunit protein bL17 Pelagibacter ubique (strain HTCC1062)
B9KZV9 1.74e-34 118 50 0 116 3 rplQ Large ribosomal subunit protein bL17 Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2)
Q5PA82 2.46e-34 119 51 2 133 3 rplQ Large ribosomal subunit protein bL17 Anaplasma marginale (strain St. Maries)
A5FN14 3.62e-34 119 51 0 117 3 rplQ Large ribosomal subunit protein bL17 Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / BCRC 14874 / CCUG 350202 / NBRC 14942 / NCIMB 11054 / UW101)
Q73PK7 4.26e-34 119 51 0 117 3 rplQ Large ribosomal subunit protein bL17 Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
B5YDX1 5.03e-34 117 49 0 116 3 rplQ Large ribosomal subunit protein bL17 Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12)
B8E1G1 5.14e-34 117 49 0 116 3 rplQ Large ribosomal subunit protein bL17 Dictyoglomus turgidum (strain DSM 6724 / Z-1310)
C6C1B2 6.98e-34 117 52 1 119 3 rplQ Large ribosomal subunit protein bL17 Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
A1VE89 9.14e-34 117 52 1 116 3 rplQ Large ribosomal subunit protein bL17 Nitratidesulfovibrio vulgaris (strain DP4)
Q72CF3 9.14e-34 117 52 1 116 3 rplQ Large ribosomal subunit protein bL17 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
B3EUJ5 9.48e-34 119 51 0 117 3 rplQ Large ribosomal subunit protein bL17 Amoebophilus asiaticus (strain 5a2)
B0TC86 1.52e-33 116 49 0 112 3 rplQ Large ribosomal subunit protein bL17 Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
Q01WC1 1.65e-33 117 52 0 116 3 rplQ Large ribosomal subunit protein bL17 Solibacter usitatus (strain Ellin6076)
A6GZ72 1.74e-33 117 51 0 117 3 rplQ Large ribosomal subunit protein bL17 Flavobacterium psychrophilum (strain ATCC 49511 / DSM 21280 / CIP 103535 / JIP02/86)
Q1IXA0 2.3e-33 115 54 0 116 3 rplQ Large ribosomal subunit protein bL17 Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
Q9RSJ5 5.81e-33 114 52 0 116 1 rplQ Large ribosomal subunit protein bL17 Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
C1CXD3 5.81e-33 114 52 0 116 3 rplQ Large ribosomal subunit protein bL17 Deinococcus deserti (strain DSM 17065 / CIP 109153 / LMG 22923 / VCD115)
B3CN50 2.99e-32 114 50 2 120 3 rplQ Large ribosomal subunit protein bL17 Wolbachia pipientis subsp. Culex pipiens (strain wPip)
A1QZT9 3.69e-32 113 48 0 119 3 rplQ Large ribosomal subunit protein bL17 Borrelia turicatae (strain 91E135)
B5RPK7 5.67e-32 112 48 0 119 3 rplQ Large ribosomal subunit protein bL17 Borrelia recurrentis (strain A1)
B5RM61 5.67e-32 112 48 0 119 3 rplQ Large ribosomal subunit protein bL17 Borrelia duttonii (strain Ly)
A0PMB8 7.55e-32 114 49 0 125 3 rplQ Large ribosomal subunit protein bL17 Mycobacterium ulcerans (strain Agy99)
B2HCX5 7.8e-32 114 49 0 125 3 rplQ Large ribosomal subunit protein bL17 Mycobacterium marinum (strain ATCC BAA-535 / M)
Q250K3 9.87e-32 111 48 0 112 3 rplQ Large ribosomal subunit protein bL17 Desulfitobacterium hafniense (strain Y51)
B8G1Z5 9.87e-32 111 48 0 112 3 rplQ Large ribosomal subunit protein bL17 Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
Q1BD07 1.2e-31 114 51 0 116 3 rplQ Large ribosomal subunit protein bL17 Mycobacterium sp. (strain MCS)
A1UBY6 1.2e-31 114 51 0 116 3 rplQ Large ribosomal subunit protein bL17 Mycobacterium sp. (strain KMS)
A3PVL9 1.2e-31 114 51 0 116 3 rplQ Large ribosomal subunit protein bL17 Mycobacterium sp. (strain JLS)
A0QKU4 1.41e-31 113 51 0 119 3 rplQ Large ribosomal subunit protein bL17 Mycobacterium avium (strain 104)
B6YQ59 1.43e-31 112 46 0 126 3 rplQ Large ribosomal subunit protein bL17 Azobacteroides pseudotrichonymphae genomovar. CFP2
A1T521 1.6e-31 114 53 0 110 3 rplQ Large ribosomal subunit protein bL17 Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
Q6NJ62 2.05e-31 112 54 0 110 3 rplQ Large ribosomal subunit protein bL17 Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
A6QCS5 2.25e-31 110 48 0 116 3 rplQ Large ribosomal subunit protein bL17 Sulfurovum sp. (strain NBC37-1)
Q2GEB5 2.37e-31 110 47 1 117 3 rplQ Large ribosomal subunit protein bL17 Neorickettsia sennetsu (strain ATCC VR-367 / Miyayama)
Q2S3N8 2.63e-31 113 47 0 117 3 rplQ Large ribosomal subunit protein bL17 Salinibacter ruber (strain DSM 13855 / M31)
A8ETK7 2.77e-31 110 43 0 116 3 rplQ Large ribosomal subunit protein bL17 Aliarcobacter butzleri (strain RM4018)
B5Y959 2.92e-31 110 46 0 113 3 rplQ Large ribosomal subunit protein bL17 Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / OCM 4 / BT)
B2S0K6 3.4e-31 110 47 0 119 3 rplQ Large ribosomal subunit protein bL17 Borrelia hermsii (strain HS1 / DAH)
Q73S42 3.43e-31 112 50 0 119 3 rplQ Large ribosomal subunit protein bL17 Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Q8R7Y3 3.82e-31 110 49 0 112 3 rplQ Large ribosomal subunit protein bL17 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q8NSV1 4.08e-31 111 53 0 110 3 rplQ Large ribosomal subunit protein bL17 Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
A4QBQ8 4.2e-31 111 51 0 118 3 rplQ Large ribosomal subunit protein bL17 Corynebacterium glutamicum (strain R)
A0RM37 4.5e-31 110 49 0 116 3 rplQ Large ribosomal subunit protein bL17 Campylobacter fetus subsp. fetus (strain 82-40)
Q9X797 5.1e-31 111 50 0 116 3 rplQ Large ribosomal subunit protein bL17 Mycobacterium leprae (strain TN)
B8ZSH5 5.1e-31 111 50 0 116 3 rplQ Large ribosomal subunit protein bL17 Mycobacterium leprae (strain Br4923)
B9KEH7 5.26e-31 109 49 0 116 3 rplQ Large ribosomal subunit protein bL17 Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060)
Q1AU57 5.3e-31 110 49 0 117 3 rplQ Large ribosomal subunit protein bL17 Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
A7HZX0 8.02e-31 109 47 0 117 3 rplQ Large ribosomal subunit protein bL17 Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
Q5GSW8 8.38e-31 110 47 2 120 3 rplQ Large ribosomal subunit protein bL17 Wolbachia sp. subsp. Brugia malayi (strain TRS)
P9WHD2 1.03e-30 111 50 0 116 3 rplQ Large ribosomal subunit protein bL17 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P9WHD3 1.29e-30 110 50 0 116 1 rplQ Large ribosomal subunit protein bL17 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
A5U8D2 1.29e-30 110 50 0 116 1 rplQ Large ribosomal subunit protein bL17 Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1AHR4 1.29e-30 110 50 0 116 3 rplQ Large ribosomal subunit protein bL17 Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KPE2 1.29e-30 110 50 0 116 3 rplQ Large ribosomal subunit protein bL17 Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P0A5V5 1.29e-30 110 50 0 116 3 rplQ Large ribosomal subunit protein bL17 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
A0QSL9 1.41e-30 111 52 0 110 1 rplQ Large ribosomal subunit protein bL17 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
A4XLQ1 1.44e-30 108 49 0 109 3 rplQ Large ribosomal subunit protein bL17 Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
B9MKF2 2.26e-30 108 48 0 109 3 rplQ Large ribosomal subunit protein bL17 Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
C1F613 2.54e-30 109 46 0 116 3 rplQ Large ribosomal subunit protein bL17 Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / BCRC 80197 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161)
C0R2Y5 2.72e-30 108 48 2 120 3 rplQ Large ribosomal subunit protein bL17 Wolbachia sp. subsp. Drosophila simulans (strain wRi)
Q73HB0 2.72e-30 108 48 2 120 3 rplQ Large ribosomal subunit protein bL17 Wolbachia pipientis wMel
B2S2G1 2.93e-30 109 50 0 117 3 rplQ Large ribosomal subunit protein bL17 Treponema pallidum subsp. pallidum (strain SS14)
O83243 2.93e-30 109 50 0 117 3 rplQ Large ribosomal subunit protein bL17 Treponema pallidum (strain Nichols)
B2UL54 3.7e-30 108 50 0 117 3 rplQ Large ribosomal subunit protein bL17 Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc)
Q8FS32 3.98e-30 109 51 0 110 3 rplQ Large ribosomal subunit protein bL17 Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q0AUL0 7.1e-30 107 46 0 113 3 rplQ Large ribosomal subunit protein bL17 Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
B2V7I4 8.55e-30 107 44 1 118 3 rplQ Large ribosomal subunit protein bL17 Sulfurihydrogenibium sp. (strain YO3AOP1)
C0ZIK8 1.2e-29 106 50 1 119 3 rplQ Large ribosomal subunit protein bL17 Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
Q17ZB3 1.21e-29 106 44 0 116 3 rplQ Large ribosomal subunit protein bL17 Helicobacter acinonychis (strain Sheeba)
A4J140 1.43e-29 106 44 0 112 3 rplQ Large ribosomal subunit protein bL17 Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
B1I1B4 1.51e-29 105 49 0 112 3 rplQ Large ribosomal subunit protein bL17 Desulforudis audaxviator (strain MP104C)
Q7M8F8 1.79e-29 105 44 0 116 3 rplQ Large ribosomal subunit protein bL17 Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q5HSJ5 1.84e-29 105 49 0 116 3 rplQ Large ribosomal subunit protein bL17 Campylobacter jejuni (strain RM1221)
A1W1J8 1.84e-29 105 49 0 116 3 rplQ Large ribosomal subunit protein bL17 Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Q0P832 1.84e-29 105 49 0 116 3 rplQ Large ribosomal subunit protein bL17 Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A8FNQ8 1.84e-29 105 49 0 116 3 rplQ Large ribosomal subunit protein bL17 Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
Q67JX2 2e-29 105 47 0 109 3 rplQ Large ribosomal subunit protein bL17 Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
B1MG98 2.15e-29 107 48 0 119 3 rplQ Large ribosomal subunit protein bL17 Mycobacteroides abscessus (strain ATCC 19977 / DSM 44196 / CCUG 20993 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543 / L948)
B9DM50 2.2e-29 105 49 1 122 3 rplQ Large ribosomal subunit protein bL17 Staphylococcus carnosus (strain TM300)
Q9ZJT6 2.28e-29 105 44 0 116 3 rplQ Large ribosomal subunit protein bL17 Helicobacter pylori (strain J99 / ATCC 700824)
Q47LM2 2.38e-29 107 50 0 111 3 rplQ Large ribosomal subunit protein bL17 Thermobifida fusca (strain YX)
O51456 2.49e-29 105 45 0 118 1 rplQ Large ribosomal subunit protein bL17 Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q661B7 3e-29 105 45 0 118 3 rplQ Large ribosomal subunit protein bL17 Borrelia garinii subsp. bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi)
Q18CI8 3.1e-29 105 48 0 109 3 rplQ Large ribosomal subunit protein bL17 Clostridioides difficile (strain 630)
Q0SN04 3.61e-29 105 45 0 118 3 rplQ Large ribosomal subunit protein bL17 Borreliella afzelii (strain PKo)
B5Z8U1 4.63e-29 104 44 0 116 3 rplQ Large ribosomal subunit protein bL17 Helicobacter pylori (strain G27)
B7J268 4.64e-29 105 45 0 118 3 rplQ Large ribosomal subunit protein bL17 Borreliella burgdorferi (strain ZS7)
B9L6T6 4.66e-29 105 45 1 120 3 rplQ Large ribosomal subunit protein bL17 Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH)
A6Q1K5 5.28e-29 104 50 0 116 3 rplQ Large ribosomal subunit protein bL17 Nitratiruptor sp. (strain SB155-2)
P56042 5.51e-29 104 44 0 116 3 rplQ Large ribosomal subunit protein bL17 Helicobacter pylori (strain ATCC 700392 / 26695)
B2UV55 5.51e-29 104 44 0 116 3 rplQ Large ribosomal subunit protein bL17 Helicobacter pylori (strain Shi470)
Q1CRW8 5.51e-29 104 44 0 116 3 rplQ Large ribosomal subunit protein bL17 Helicobacter pylori (strain HPAG1)
B6JND2 5.51e-29 104 44 0 116 3 rplQ Large ribosomal subunit protein bL17 Helicobacter pylori (strain P12)
Q54TY5 9.03e-29 106 46 0 117 3 mrpl17 Large ribosomal subunit protein bL17m Dictyostelium discoideum
Q65P78 1.01e-28 104 48 2 121 3 rplQ Large ribosomal subunit protein bL17 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q30TS2 1.08e-28 103 51 2 117 3 rplQ Large ribosomal subunit protein bL17 Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_19115
Feature type CDS
Gene rplQ
Product 50S ribosomal protein L17
Location 9752 - 10138 (strand: -1)
Length 387 (nucleotides) / 128 (amino acids)
In genomic island -

Contig

Accession contig_38
Length 24827 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2406
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01196 Ribosomal protein L17

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0203 Translation, ribosomal structure and biogenesis (J) J Ribosomal protein L17

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02879 large subunit ribosomal protein L17 Ribosome -

Protein Sequence

MRHRMSGRQLNRNSSHRQAMFRNMAGSLVRHEIIKTTLPKAKELRRVVEPLITLAKTDSVANRRLAFARTRDNEIVAKLFNELGPRFAQRAGGYTRILKCGFRAGDNAPMAYIELVDRAESQTEAAAE

Flanking regions ( +/- flanking 50bp)

TGCTGACGAATAAGATCACAGGTTAAGGTTTTACTGAGAAGGATAAGGTCATGCGCCATCGTATGAGTGGTCGTCAATTGAACCGCAACAGCAGCCATCGCCAAGCTATGTTTCGTAACATGGCCGGTTCTTTAGTTCGTCACGAAATTATCAAGACGACTTTGCCTAAGGCAAAAGAACTGCGTCGCGTTGTTGAGCCGTTGATTACCCTGGCTAAAACGGATAGCGTTGCTAACCGTCGTTTAGCATTCGCCCGTACTCGTGATAACGAAATCGTGGCAAAACTGTTCAACGAGCTGGGACCACGTTTCGCTCAGCGTGCAGGTGGTTACACCCGCATTCTGAAATGTGGTTTCCGTGCTGGTGACAATGCTCCAATGGCTTACATTGAGCTTGTTGACCGCGCTGAATCCCAGACTGAAGCAGCAGCAGAGTAATCTGTTACTGCGTAAAAAACCGGGTTTTTACCCGGTTTTTTTATTTCTGT