Homologs in group_2366

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_18825 EHELCC_18825 100.0 Morganella morganii S2 def peptide deformylase
NLDBIP_18840 NLDBIP_18840 100.0 Morganella morganii S4 def peptide deformylase
LHKJJB_18695 LHKJJB_18695 100.0 Morganella morganii S3 def peptide deformylase
HKOGLL_18430 HKOGLL_18430 100.0 Morganella morganii S5 def peptide deformylase
F4V73_RS19085 F4V73_RS19085 95.3 Morganella psychrotolerans def peptide deformylase
PMI_RS16310 PMI_RS16310 84.0 Proteus mirabilis HI4320 def peptide deformylase

Distribution of the homologs in the orthogroup group_2366

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2366

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7MYI2 5.74e-101 290 83 0 169 3 def Peptide deformylase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q8Z1W9 1.63e-99 286 84 0 169 3 def Peptide deformylase Salmonella typhi
A9MN80 1.63e-99 286 84 0 169 3 def Peptide deformylase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q32B63 1.26e-98 284 83 0 169 3 def Peptide deformylase Shigella dysenteriae serotype 1 (strain Sd197)
Q31VZ0 1.26e-98 284 83 0 169 3 def Peptide deformylase Shigella boydii serotype 4 (strain Sb227)
B7LRQ3 1.26e-98 284 83 0 169 3 def Peptide deformylase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1R646 1.26e-98 284 83 0 169 3 def Peptide deformylase Escherichia coli (strain UTI89 / UPEC)
B6I200 1.26e-98 284 83 0 169 3 def Peptide deformylase Escherichia coli (strain SE11)
B7NDQ8 1.26e-98 284 83 0 169 3 def Peptide deformylase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A6K3 1.26e-98 284 83 0 169 1 def Peptide deformylase Escherichia coli (strain K12)
B1IQ13 1.26e-98 284 83 0 169 3 def Peptide deformylase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A6K4 1.26e-98 284 83 0 169 3 def Peptide deformylase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TCH5 1.26e-98 284 83 0 169 3 def Peptide deformylase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AGH8 1.26e-98 284 83 0 169 3 def Peptide deformylase Escherichia coli O1:K1 / APEC
A8A591 1.26e-98 284 83 0 169 3 def Peptide deformylase Escherichia coli O9:H4 (strain HS)
B1X6D9 1.26e-98 284 83 0 169 3 def Peptide deformylase Escherichia coli (strain K12 / DH10B)
C4ZUE1 1.26e-98 284 83 0 169 3 def Peptide deformylase Escherichia coli (strain K12 / MC4100 / BW2952)
B7M0Z2 1.26e-98 284 83 0 169 3 def Peptide deformylase Escherichia coli O8 (strain IAI1)
B7N171 1.26e-98 284 83 0 169 3 def Peptide deformylase Escherichia coli O81 (strain ED1a)
B5YT06 1.26e-98 284 83 0 169 3 def Peptide deformylase Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A6K5 1.26e-98 284 83 0 169 3 def Peptide deformylase Escherichia coli O157:H7
B7LHY3 1.26e-98 284 83 0 169 3 def Peptide deformylase Escherichia coli (strain 55989 / EAEC)
B7MCQ2 1.26e-98 284 83 0 169 3 def Peptide deformylase Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UK10 1.26e-98 284 83 0 169 3 def Peptide deformylase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q3YWX3 1.52e-98 284 83 0 169 3 def Peptide deformylase Shigella sonnei (strain Ss046)
Q83PZ1 1.52e-98 284 83 0 169 3 def Peptide deformylase Shigella flexneri
Q0T016 1.52e-98 284 83 0 169 3 def Peptide deformylase Shigella flexneri serotype 5b (strain 8401)
B1LGP3 1.52e-98 284 83 0 169 3 def Peptide deformylase Escherichia coli (strain SMS-3-5 / SECEC)
B7NLK6 1.52e-98 284 83 0 169 3 def Peptide deformylase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Q8ZLM7 2.03e-98 284 83 0 169 3 def Peptide deformylase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TXB0 2.03e-98 284 83 0 169 3 def Peptide deformylase Salmonella schwarzengrund (strain CVM19633)
B5BGV3 2.03e-98 284 83 0 169 3 def Peptide deformylase Salmonella paratyphi A (strain AKU_12601)
A9N8B1 2.03e-98 284 83 0 169 3 def Peptide deformylase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PIT8 2.03e-98 284 83 0 169 3 def Peptide deformylase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SUQ8 2.03e-98 284 83 0 169 3 def Peptide deformylase Salmonella newport (strain SL254)
B4TJX7 2.03e-98 284 83 0 169 3 def Peptide deformylase Salmonella heidelberg (strain SL476)
B5RH49 2.03e-98 284 83 0 169 3 def Peptide deformylase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R1E3 2.03e-98 284 83 0 169 3 def Peptide deformylase Salmonella enteritidis PT4 (strain P125109)
B5FJI2 2.03e-98 284 83 0 169 3 def Peptide deformylase Salmonella dublin (strain CT_02021853)
Q57J64 2.03e-98 284 83 0 169 3 def Peptide deformylase Salmonella choleraesuis (strain SC-B67)
B5F7R3 2.03e-98 284 83 0 169 3 def Peptide deformylase Salmonella agona (strain SL483)
B2U2Q4 3.83e-98 283 82 0 169 3 def Peptide deformylase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
A8AQI1 7.89e-98 282 83 0 169 3 def Peptide deformylase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A8GKG5 5.2e-97 280 80 0 169 3 def Peptide deformylase Serratia proteamaculans (strain 568)
B5XNC4 2.61e-96 278 81 0 169 3 def Peptide deformylase Klebsiella pneumoniae (strain 342)
A7MPE9 7.91e-96 277 80 0 169 3 def Peptide deformylase Cronobacter sakazakii (strain ATCC BAA-894)
B1JJH8 9.32e-96 277 79 0 169 3 def Peptide deformylase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q664V4 9.32e-96 277 79 0 169 3 def Peptide deformylase Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TH23 9.32e-96 277 79 0 169 3 def Peptide deformylase Yersinia pestis (strain Pestoides F)
Q1CCX6 9.32e-96 277 79 0 169 3 def Peptide deformylase Yersinia pestis bv. Antiqua (strain Nepal516)
A9R927 9.32e-96 277 79 0 169 3 def Peptide deformylase Yersinia pestis bv. Antiqua (strain Angola)
Q8ZJ79 9.32e-96 277 79 0 169 3 def Peptide deformylase Yersinia pestis
B2K504 9.32e-96 277 79 0 169 3 def Peptide deformylase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C2X9 9.32e-96 277 79 0 169 3 def Peptide deformylase Yersinia pestis bv. Antiqua (strain Antiqua)
A7FNK2 9.32e-96 277 79 0 169 3 def Peptide deformylase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A6TEU0 1.84e-95 276 80 0 169 3 def Peptide deformylase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A1JRZ1 2.79e-95 276 79 0 169 3 def Peptide deformylase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A4WF95 1.9e-94 274 79 0 169 3 def Peptide deformylase Enterobacter sp. (strain 638)
Q2NQQ4 2.12e-94 274 78 0 169 3 def Peptide deformylase Sodalis glossinidius (strain morsitans)
B2VK93 5.32e-94 273 80 0 168 3 def Peptide deformylase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
C6DFR5 5.69e-93 270 76 0 169 3 def Peptide deformylase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6D002 1.07e-92 269 76 0 169 3 def Peptide deformylase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
C5BF17 1.07e-90 264 76 0 169 3 def Peptide deformylase Edwardsiella ictaluri (strain 93-146)
A4ST57 5.08e-87 255 75 0 164 3 def Peptide deformylase Aeromonas salmonicida (strain A449)
C4L7Y4 1.1e-83 246 70 0 164 3 def Peptide deformylase Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q8DDE3 3.33e-82 243 69 0 168 3 def1 Peptide deformylase 1 Vibrio vulnificus (strain CMCP6)
Q7MGK6 2.07e-81 242 69 0 168 3 def2 Peptide deformylase 2 Vibrio vulnificus (strain YJ016)
C4K6Y0 3.96e-81 240 67 0 168 3 def Peptide deformylase Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
Q1LT56 3.09e-79 235 67 0 164 3 def Peptide deformylase Baumannia cicadellinicola subsp. Homalodisca coagulata
Q87KD5 4.31e-79 235 66 0 168 3 def1 Peptide deformylase 1 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q9KVU3 5.66e-79 234 64 0 168 1 def1 Peptide deformylase 1 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A7N121 2.28e-78 233 66 0 168 3 def Peptide deformylase Vibrio campbellii (strain ATCC BAA-1116)
B5FCW6 4.99e-73 219 66 0 154 3 def Peptide deformylase Aliivibrio fischeri (strain MJ11)
Q5E1Q8 4.99e-73 219 66 0 154 3 def Peptide deformylase Aliivibrio fischeri (strain ATCC 700601 / ES114)
B6EP21 2.28e-71 215 64 0 154 3 def Peptide deformylase Aliivibrio salmonicida (strain LFI1238)
B4S291 1.15e-70 213 61 0 169 3 def Peptide deformylase Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
Q7NQ75 1.67e-70 213 62 0 164 3 def Peptide deformylase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q3IDI2 1.73e-70 213 65 0 161 3 def Peptide deformylase Pseudoalteromonas translucida (strain TAC 125)
Q5QXI5 1.13e-69 211 61 0 165 3 def Peptide deformylase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
P57948 6.82e-69 209 62 0 168 3 def Peptide deformylase Pasteurella multocida (strain Pm70)
P44786 4.63e-68 207 60 0 169 3 def Peptide deformylase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q0I181 1.54e-67 206 57 0 169 3 def Peptide deformylase Histophilus somni (strain 129Pt)
B8D821 2.39e-67 205 54 0 164 3 def Peptide deformylase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57563 2.39e-67 205 54 0 164 3 def Peptide deformylase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D9R9 2.39e-67 205 54 0 164 3 def Peptide deformylase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
A5UH92 3.08e-67 205 60 0 169 3 def Peptide deformylase Haemophilus influenzae (strain PittGG)
A5UEB4 3.08e-67 205 60 0 169 3 def Peptide deformylase Haemophilus influenzae (strain PittEE)
Q4QMV6 3.08e-67 205 60 0 169 1 def Peptide deformylase Haemophilus influenzae (strain 86-028NP)
B0UWZ5 5.61e-67 204 57 0 169 3 def Peptide deformylase Histophilus somni (strain 2336)
B8F726 1.73e-66 203 57 0 164 3 def Peptide deformylase Glaesserella parasuis serovar 5 (strain SH0165)
B8GU11 2.53e-66 203 64 0 164 3 def Peptide deformylase Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q3J6U0 1.42e-65 201 56 0 167 3 def Peptide deformylase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q7VQC0 5.79e-65 199 56 1 166 3 def Peptide deformylase Blochmanniella floridana
Q8EKQ8 7.47e-65 199 58 0 168 3 def1 Peptide deformylase 1 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
C1DFV8 1.06e-64 198 59 1 165 3 def Peptide deformylase Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q2SQX1 1.54e-64 198 56 1 168 3 def Peptide deformylase Hahella chejuensis (strain KCTC 2396)
B1XSN2 4.02e-64 197 59 1 162 3 def Peptide deformylase Polynucleobacter necessarius subsp. necessarius (strain STIR1)
A4XNB3 4.16e-64 197 58 1 168 3 def Peptide deformylase Pseudomonas mendocina (strain ymp)
Q8K975 4.65e-64 197 59 0 153 3 def Peptide deformylase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
A0A0H3KB98 4.87e-64 197 59 1 165 1 def1 Peptide deformylase 1 Burkholderia multivorans (strain ATCC 17616 / 249)
Q1QTJ5 1.35e-63 196 60 1 165 3 def Peptide deformylase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
B3GYT7 2.5e-63 195 55 0 169 3 def Peptide deformylase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
Q0A5B9 2.57e-63 195 58 1 165 3 def Peptide deformylase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q65QF2 3.55e-63 194 59 0 168 3 def Peptide deformylase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
A4VFH8 3.71e-63 194 56 1 168 3 def Peptide deformylase Stutzerimonas stutzeri (strain A1501)
Q88B43 4.77e-63 194 55 1 168 3 def1 Peptide deformylase 1 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q5F5P6 6.41e-63 194 58 0 161 3 def Peptide deformylase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
A1KRE5 9.93e-63 193 57 0 161 3 def Peptide deformylase Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
P63916 9.93e-63 193 57 0 161 3 def Peptide deformylase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P63915 9.93e-63 193 57 0 161 3 def Peptide deformylase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9M464 9.93e-63 193 57 0 161 3 def Peptide deformylase Neisseria meningitidis serogroup C (strain 053442)
Q7VKK9 1.79e-62 193 53 0 169 3 def Peptide deformylase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
B3PGY7 2.68e-62 192 57 1 162 3 def Peptide deformylase Cellvibrio japonicus (strain Ueda107)
C5BKQ0 2.72e-62 192 58 2 169 3 def Peptide deformylase Teredinibacter turnerae (strain ATCC 39867 / T7901)
Q21PV5 4.89e-62 192 56 2 171 3 def Peptide deformylase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q8Y3B0 5.06e-62 192 58 1 169 3 def1 Peptide deformylase 1 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q0VTE1 9.55e-62 191 57 1 165 3 def Peptide deformylase Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q82TC8 1.94e-61 191 57 0 164 3 def2 Peptide deformylase 2 Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q8P4F9 2.47e-61 190 56 1 165 3 def2 Peptide deformylase 2 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q7VS88 4.97e-61 189 56 1 165 3 def2 Peptide deformylase 2 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W1V3 4.97e-61 189 56 1 165 3 def1 Peptide deformylase 1 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WQS9 4.97e-61 189 56 1 165 3 def1 Peptide deformylase 1 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q9I7A8 5.49e-61 189 55 1 168 1 def Peptide deformylase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q8D258 7.7e-61 188 54 0 152 3 def Peptide deformylase Wigglesworthia glossinidia brevipalpis
B0VNL8 8e-61 189 56 1 169 1 def Peptide deformylase Acinetobacter baumannii (strain SDF)
Q88RR1 4.63e-60 187 52 1 168 3 def1 Peptide deformylase 1 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q8PG20 6.8e-59 184 54 1 164 3 def2 Peptide deformylase 2 Xanthomonas axonopodis pv. citri (strain 306)
B2FIR4 7.43e-59 184 54 1 164 3 def Peptide deformylase Stenotrophomonas maltophilia (strain K279a)
B4SKH7 1.58e-58 183 54 1 164 3 def Peptide deformylase Stenotrophomonas maltophilia (strain R551-3)
Q493I1 3.57e-58 182 55 0 150 3 def Peptide deformylase Blochmanniella pennsylvanica (strain BPEN)
B0U4M4 2.15e-57 180 53 1 167 3 def Peptide deformylase Xylella fastidiosa (strain M12)
P63918 3.33e-57 179 54 1 167 3 def Peptide deformylase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
P63917 3.33e-57 179 54 1 167 3 def Peptide deformylase Xylella fastidiosa (strain 9a5c)
B2I8S4 3.33e-57 179 54 1 167 3 def Peptide deformylase Xylella fastidiosa (strain M23)
P59493 3.44e-57 179 52 0 158 3 def Peptide deformylase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q8EE60 1.02e-53 170 54 2 162 3 def3 Peptide deformylase 3 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q31J84 1.55e-53 170 49 0 161 3 def Peptide deformylase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
A5WBG1 4.23e-53 169 52 1 169 3 def Peptide deformylase Psychrobacter sp. (strain PRwf-1)
Q1QET1 1.02e-52 169 52 1 169 3 def Peptide deformylase Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q4FVQ4 3.7e-52 167 51 1 169 3 def Peptide deformylase Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q8D5P5 2.51e-49 159 48 2 169 3 def2 Peptide deformylase 2 Vibrio vulnificus (strain CMCP6)
Q7MCQ2 1.52e-48 157 48 2 169 3 def1 Peptide deformylase 1 Vibrio vulnificus (strain YJ016)
B6JJP8 2.6e-48 157 46 2 171 3 def Peptide deformylase Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
A5VDM3 5.8e-47 154 49 3 175 3 def Peptide deformylase Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
Q87I22 6.61e-47 153 46 2 169 3 def2 Peptide deformylase 2 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q9KN16 7.78e-47 153 47 2 169 1 def2 Peptide deformylase 2 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q6G5F0 2.17e-46 152 48 2 164 3 def Peptide deformylase Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
A5EWL8 2.58e-46 152 45 2 173 3 def Peptide deformylase Dichelobacter nodosus (strain VCS1703A)
Q9ZDV8 2.65e-46 152 49 3 170 3 def Peptide deformylase Rickettsia prowazekii (strain Madrid E)
B8ENG6 2.98e-46 152 47 2 174 3 def Peptide deformylase Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
Q68XG1 6.27e-46 151 48 3 170 3 def Peptide deformylase Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q92IZ1 1.25e-45 150 46 2 170 3 def1 Peptide deformylase 1 Rickettsia conorii (strain ATCC VR-613 / Malish 7)
A9ILK4 2.43e-45 149 46 2 166 3 def Peptide deformylase Bartonella tribocorum (strain CIP 105476 / IBS 506)
Q6G1G6 2.88e-45 149 47 2 164 3 def Peptide deformylase Bartonella quintana (strain Toulouse)
Q89BN9 4.23e-45 149 48 2 168 3 def Peptide deformylase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
A8GMJ8 8.03e-45 148 47 3 170 3 def Peptide deformylase Rickettsia akari (strain Hartford)
B5YIL7 2.29e-44 147 46 2 160 3 def Peptide deformylase Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
A5ESQ7 2.78e-44 147 48 2 168 3 def Peptide deformylase Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
C1F541 3.28e-44 146 44 1 166 3 def Peptide deformylase Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / BCRC 80197 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161)
A4YLB9 4.02e-44 146 48 2 168 3 def Peptide deformylase Bradyrhizobium sp. (strain ORS 278)
Q0C4V1 4.72e-44 146 49 3 165 3 def Peptide deformylase Hyphomonas neptunium (strain ATCC 15444)
Q4FNG1 1.23e-43 145 44 2 169 3 def Peptide deformylase Pelagibacter ubique (strain HTCC1062)
Q92SH6 4.62e-43 144 42 2 170 3 def Peptide deformylase Rhizobium meliloti (strain 1021)
Q0ASK2 6.27e-43 143 43 2 171 3 def Peptide deformylase Maricaulis maris (strain MCS10)
Q21B62 6.46e-43 143 47 2 166 3 def Peptide deformylase Rhodopseudomonas palustris (strain BisB18)
B4RDT8 7.82e-43 143 47 2 157 3 def Peptide deformylase Phenylobacterium zucineum (strain HLK1)
A8EXV2 1.66e-42 142 45 3 170 3 def Peptide deformylase Rickettsia canadensis (strain McKiel)
Q13F18 1.86e-42 142 47 2 166 3 def Peptide deformylase Rhodopseudomonas palustris (strain BisB5)
O05100 2.07e-42 141 52 1 148 3 def1 Peptide deformylase 1 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
B3QCH1 2.78e-42 142 46 2 166 3 def Peptide deformylase Rhodopseudomonas palustris (strain TIE-1)
Q6NC51 2.78e-42 142 46 2 166 3 def Peptide deformylase Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
P63914 4.2e-42 141 42 2 170 3 def Peptide deformylase Brucella suis biovar 1 (strain 1330)
P63913 4.2e-42 141 42 2 170 3 def Peptide deformylase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
B8FHH0 5.44e-42 141 44 2 166 3 def Peptide deformylase Desulfatibacillum aliphaticivorans
Q11LC7 6.1e-42 141 45 2 169 3 def Peptide deformylase Chelativorans sp. (strain BNC1)
Q07TX0 1.03e-41 140 46 2 166 3 def Peptide deformylase Rhodopseudomonas palustris (strain BisA53)
Q2G491 1.37e-41 140 42 2 184 3 def Peptide deformylase Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
Q9REQ2 2.13e-41 139 45 2 176 3 def Peptide deformylase Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
A1UUB4 2.69e-41 139 45 2 170 3 def Peptide deformylase Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
Q2J2C6 3.04e-41 139 45 2 166 3 def Peptide deformylase Rhodopseudomonas palustris (strain HaA2)
A0LEJ7 9.37e-41 137 45 1 154 3 def Peptide deformylase Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
B8GYE3 1.48e-40 137 46 3 166 3 def Peptide deformylase Caulobacter vibrioides (strain NA1000 / CB15N)
Q9ABF5 1.48e-40 137 46 3 166 3 def Peptide deformylase Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q1QH78 1.66e-40 137 43 2 175 3 def Peptide deformylase Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q98D52 2.69e-40 137 45 2 158 3 def Peptide deformylase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q6AQ98 1.06e-39 135 41 1 165 3 def Peptide deformylase Desulfotalea psychrophila (strain LSv54 / DSM 12343)
A8ZUK5 1.38e-39 135 42 2 164 3 def Peptide deformylase Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)
Q8UID1 2.45e-39 134 42 2 169 3 def Peptide deformylase Agrobacterium fabrum (strain C58 / ATCC 33970)
Q8XJL2 5.27e-39 132 49 1 146 3 def1 Peptide deformylase 1 Clostridium perfringens (strain 13 / Type A)
Q057D2 1.75e-38 131 46 1 149 3 def Peptide deformylase Buchnera aphidicola subsp. Cinara cedri (strain Cc)
Q83CV9 3.29e-38 131 44 4 167 3 def1 Peptide deformylase 1 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
B6JM24 7.72e-38 130 42 1 173 3 def Peptide deformylase Helicobacter pylori (strain P12)
B0TGS8 9.52e-38 129 45 1 145 3 def Peptide deformylase Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
A9KM99 1.09e-37 130 46 0 139 3 def Peptide deformylase Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
Q1CT77 1.71e-37 129 43 1 169 3 def Peptide deformylase Helicobacter pylori (strain HPAG1)
B5Z7F5 1.78e-37 129 43 1 169 3 def Peptide deformylase Helicobacter pylori (strain G27)
B3DUG9 2.16e-37 130 39 1 178 3 def Peptide deformylase Methylacidiphilum infernorum (isolate V4)
P56419 2.19e-37 129 42 1 169 3 def Peptide deformylase Helicobacter pylori (strain ATCC 700392 / 26695)
B3CMB1 2.42e-37 129 41 2 175 3 def Peptide deformylase Wolbachia pipientis subsp. Culex pipiens (strain wPip)
O66847 3.03e-37 129 41 1 164 3 def Peptide deformylase Aquifex aeolicus (strain VF5)
Q17XD4 3.37e-37 129 42 1 169 3 def Peptide deformylase Helicobacter acinonychis (strain Sheeba)
Q9ZL51 4.34e-37 129 42 1 169 3 def Peptide deformylase Helicobacter pylori (strain J99 / ATCC 700824)
Q0AXL3 4.4e-37 128 41 2 162 3 def Peptide deformylase Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
B2UT38 6.12e-37 128 42 1 169 3 def Peptide deformylase Helicobacter pylori (strain Shi470)
Q24U09 6.27e-37 127 47 2 154 3 def Peptide deformylase Desulfitobacterium hafniense (strain Y51)
B0T1S9 6.87e-37 128 46 2 154 3 def Peptide deformylase Caulobacter sp. (strain K31)
B9L6X1 9.08e-37 127 39 1 162 3 def Peptide deformylase Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH)
Q5GTG9 1.08e-36 127 40 2 175 3 def Peptide deformylase Wolbachia sp. subsp. Brugia malayi (strain TRS)
Q2NCT3 1.4e-36 128 37 3 190 3 def Peptide deformylase Erythrobacter litoralis (strain HTCC2594)
P94601 1.45e-36 127 51 3 143 3 def Peptide deformylase Microchaete diplosiphon
C0R5A2 1.99e-36 127 41 2 175 3 def Peptide deformylase Wolbachia sp. subsp. Drosophila simulans (strain wRi)
Q73IJ6 2.12e-36 127 40 2 175 3 def Peptide deformylase Wolbachia pipientis wMel
B3CTU1 2.61e-36 127 39 2 174 3 def Peptide deformylase Orientia tsutsugamushi (strain Ikeda)
C0QI55 2.72e-36 126 42 2 169 3 def Peptide deformylase Desulforapulum autotrophicum (strain ATCC 43914 / DSM 3382 / VKM B-1955 / HRM2)
C0QZQ2 4.46e-36 126 40 2 160 3 def Peptide deformylase Brachyspira hyodysenteriae (strain ATCC 49526 / WA1)
Q2RK25 4.51e-36 125 44 1 145 3 def Peptide deformylase Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q67PR5 5.21e-36 127 43 0 151 3 def Peptide deformylase Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
A5CF65 6.78e-36 125 37 2 174 3 def Peptide deformylase Orientia tsutsugamushi (strain Boryong)
B8FS81 9.01e-36 124 45 1 153 3 def Peptide deformylase Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
B1GZ10 1.3e-35 124 42 0 155 3 def Peptide deformylase Endomicrobium trichonymphae
B0S139 1.25e-34 122 45 2 146 3 def Peptide deformylase Finegoldia magna (strain ATCC 29328 / DSM 20472 / WAL 2508)
Q895Q2 8.92e-34 119 43 1 151 3 def Peptide deformylase Clostridium tetani (strain Massachusetts / E88)
C4ZEV9 9.74e-34 119 45 1 145 3 def Peptide deformylase Agathobacter rectalis (strain ATCC 33656 / DSM 3377 / JCM 17463 / KCTC 5835 / VPI 0990)
B8CWS6 1.65e-33 119 42 1 145 3 def Peptide deformylase Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562)
Q7M7M2 1.66e-33 119 38 1 167 3 def Peptide deformylase Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q8YSK6 1.8e-33 120 48 3 143 3 def1 Peptide deformylase 1 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
B3EPG5 2.31e-33 119 40 1 166 3 def Peptide deformylase Chlorobium phaeobacteroides (strain BS1)
B2V4B1 2.45e-33 118 47 1 145 3 def Peptide deformylase Clostridium botulinum (strain Alaska E43 / Type E3)
B9MR36 7.8e-33 117 43 2 167 3 def Peptide deformylase Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
Q8R9T0 1.92e-32 116 48 1 145 3 def Peptide deformylase Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q3B2U9 2.22e-32 117 39 1 164 3 def Peptide deformylase Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
P94462 2.4e-32 116 45 1 148 3 defA Peptide deformylase 1 Bacillus subtilis (strain 168)
Q7NIF5 3.48e-32 116 45 2 138 3 def2 Peptide deformylase 2 Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
A3DCX4 4.29e-32 115 45 1 145 3 def Peptide deformylase Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q2S316 4.45e-32 116 41 2 160 3 def Peptide deformylase Salinibacter ruber (strain DSM 13855 / M31)
A8F524 5.13e-32 115 44 2 150 3 def Peptide deformylase Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO)
Q3Z8F6 6.42e-32 115 40 1 149 3 def Peptide deformylase Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195)
A6TRW8 9.41e-32 114 43 1 147 3 def Peptide deformylase Alkaliphilus metalliredigens (strain QYMF)
B9K7G9 1.21e-31 114 44 2 152 3 def Peptide deformylase Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E)
Q7V3K7 1.26e-31 115 44 2 149 3 def Peptide deformylase Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
Q3AC18 1.35e-31 114 41 1 153 3 def Peptide deformylase Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
P96113 1.35e-31 114 42 2 161 1 def Peptide deformylase Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
B3EE19 1.39e-31 115 40 3 161 3 def Peptide deformylase Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
A2BZN6 1.61e-31 115 40 3 172 3 def Peptide deformylase Prochlorococcus marinus (strain NATL1A)
B4S9B9 1.68e-31 114 37 3 167 3 def Peptide deformylase Prosthecochloris aestuarii (strain DSM 271 / SK 413)
B1LB14 1.9e-31 114 42 2 161 3 def Peptide deformylase Thermotoga sp. (strain RQ2)
A5D1C0 3.23e-31 113 39 2 163 3 def Peptide deformylase Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
A5ILS1 4.78e-31 113 42 2 161 3 def Peptide deformylase Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
A2BNK7 5.47e-31 114 42 2 150 3 def Peptide deformylase Prochlorococcus marinus (strain AS9601)
Q11X86 5.76e-31 113 39 2 168 3 def Peptide deformylase Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)
Q9FV54 5.98e-31 115 40 2 164 2 PDF1B Peptide deformylase 1B, chloroplastic Solanum lycopersicum
Q31DB4 6.43e-31 114 40 3 166 3 def Peptide deformylase Prochlorococcus marinus (strain MIT 9312)
B3QPU5 7.02e-31 113 35 3 174 3 def Peptide deformylase Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
Q2GE16 8.04e-31 113 37 2 180 3 def Peptide deformylase Neorickettsia sennetsu (strain ATCC VR-367 / Miyayama)
A5FRA7 9.02e-31 112 39 1 149 3 def Peptide deformylase Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1)
Q3ZXA9 1.04e-30 112 39 1 149 3 def Peptide deformylase Dehalococcoides mccartyi (strain CBDB1)
B4SBG6 1.41e-30 112 39 3 167 3 def Peptide deformylase Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
Q46HV9 1.8e-30 112 43 2 148 3 def Peptide deformylase Prochlorococcus marinus (strain NATL2A)
A4SFP2 2.46e-30 112 35 1 166 3 def Peptide deformylase Chlorobium phaeovibrioides (strain DSM 265 / 1930)
Q9PIT8 2.63e-30 111 40 2 154 3 def Peptide deformylase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
B9L0C1 2.76e-30 111 41 1 151 3 def Peptide deformylase Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2)
B1XJP0 2.98e-30 111 44 5 159 3 def Peptide deformylase Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
A5GQU9 5.67e-30 111 46 2 138 3 def Peptide deformylase Synechococcus sp. (strain RCC307)
Q8KCG7 9.46e-30 110 36 3 174 3 def Peptide deformylase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q81WH1 9.86e-30 109 41 1 148 3 def1 Peptide deformylase 1 Bacillus anthracis
Q3AHC4 1.08e-29 110 45 2 141 3 def Peptide deformylase Synechococcus sp. (strain CC9605)
Q7UHZ5 1.17e-29 110 35 1 147 3 def Peptide deformylase Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Q7VIN5 1.56e-29 109 39 1 156 3 def Peptide deformylase Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Q97G95 2.24e-29 108 41 2 149 3 def2 Peptide deformylase 2 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
A2BU25 2.47e-29 109 42 2 149 3 def Peptide deformylase Prochlorococcus marinus (strain MIT 9515)
A1BHK0 3.47e-29 108 39 4 167 3 def Peptide deformylase Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
A6L9R8 4.68e-29 108 39 2 168 3 def Peptide deformylase Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
Q7V5F9 7.59e-29 108 43 2 138 3 def2 Peptide deformylase 2 Prochlorococcus marinus (strain MIT 9313)
Q7VED2 8.33e-29 108 44 2 138 3 def Peptide deformylase Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
Q0I7A5 1.07e-28 108 43 2 141 3 def Peptide deformylase Synechococcus sp. (strain CC9311)
P73441 1.81e-28 107 41 3 143 3 def Peptide deformylase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q8AAP4 3.98e-28 106 33 2 175 3 def Peptide deformylase Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
B0KA11 4.87e-28 105 46 1 145 3 def Peptide deformylase Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
B0K292 5.06e-28 105 46 1 145 3 def Peptide deformylase Thermoanaerobacter sp. (strain X514)
Q9FUZ2 6.61e-28 107 38 2 164 1 PDF1B Peptide deformylase 1B, chloroplastic/mitochondrial Arabidopsis thaliana
Q7U9D4 8.16e-28 105 44 2 140 3 def Peptide deformylase Parasynechococcus marenigrum (strain WH8102)
Q92HU7 8.89e-28 105 36 2 163 3 RC0674 Peptide deformylase-like Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q8DIB4 1.05e-27 105 46 3 143 3 def Peptide deformylase Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q3AZU8 1.71e-27 105 43 2 138 3 def Peptide deformylase Synechococcus sp. (strain CC9902)
Q8NQ46 2.28e-27 103 41 3 156 3 def1 Peptide deformylase 1 Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
B2KD65 9.64e-27 102 32 2 173 3 def Peptide deformylase Elusimicrobium minutum (strain Pei191)
A8Z5V9 1.22e-26 102 33 2 161 3 def Peptide deformylase Karelsulcia muelleri (strain GWSS)
B2A2K1 1.34e-26 101 40 2 146 3 def Peptide deformylase Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
A6H0E7 1.53e-26 102 34 3 181 3 def Peptide deformylase Flavobacterium psychrophilum (strain ATCC 49511 / DSM 21280 / CIP 103535 / JIP02/86)
A0LUE1 1.93e-26 101 37 1 153 3 def Peptide deformylase Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B)
B5YF46 2.41e-26 100 44 1 135 3 def Peptide deformylase Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12)
B8E0X7 2.96e-26 100 45 1 135 3 def Peptide deformylase Dictyoglomus turgidum (strain DSM 6724 / Z-1310)
B9LBS4 3.19e-26 101 38 4 173 3 def Peptide deformylase Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl)
A9WHG7 3.19e-26 101 38 4 173 3 def Peptide deformylase Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
B3ETT4 3.63e-26 101 35 3 174 3 def Peptide deformylase Amoebophilus asiaticus (strain 5a2)
A6L7J9 3.98e-26 100 34 2 175 3 def Peptide deformylase Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
Q92QD0 6.31e-26 100 32 2 168 3 R01402 Peptide deformylase-like Rhizobium meliloti (strain 1021)
Q8FT51 8.06e-26 99 39 3 156 3 def1 Peptide deformylase 1 Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q5VNN5 8.42e-26 102 35 2 164 2 PDF1B Peptide deformylase 1B, chloroplastic Oryza sativa subsp. japonica
O51092 9.02e-26 99 42 3 145 3 def Peptide deformylase Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
A0M3P3 1.21e-25 100 37 3 177 3 def Peptide deformylase Christiangramia forsetii (strain DSM 17595 / CGMCC 1.15422 / KT0803)
Q819U0 3.12e-25 97 41 1 148 1 def1 Peptide deformylase 1 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q8XJX0 6.19e-25 97 39 3 146 3 def2 Peptide deformylase 2 Clostridium perfringens (strain 13 / Type A)
Q826Q0 6.47e-25 97 34 5 176 3 def2 Peptide deformylase 2 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q93LE9 8.16e-25 97 36 4 164 1 def Peptide deformylase Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72S74 8.16e-25 97 36 4 164 3 def Peptide deformylase Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q64VP5 1.14e-24 97 32 2 175 3 def Peptide deformylase Bacteroides fragilis (strain YCH46)
Q5LEQ9 1.14e-24 97 32 2 175 3 def Peptide deformylase Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
B1ZMD5 1.8e-24 97 31 2 180 3 def Peptide deformylase Opitutus terrae (strain DSM 11246 / JCM 15787 / PB90-1)
Q83HQ3 3.14e-24 96 37 4 172 3 def Peptide deformylase Tropheryma whipplei (strain TW08/27)
Q7MT07 3.16e-24 96 32 2 175 3 def Peptide deformylase Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
B2RMJ1 3.16e-24 96 32 2 175 3 def Peptide deformylase Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)
Q7NAK8 3.28e-24 96 37 4 138 3 def Peptide deformylase Mycoplasmoides gallisepticum (strain R(low / passage 15 / clone 2))
B8G5R5 3.39e-24 96 36 4 173 3 def Peptide deformylase Chloroflexus aggregans (strain MD-66 / DSM 9485)
Q83GH8 4.87e-24 96 37 4 172 3 def Peptide deformylase Tropheryma whipplei (strain Twist)
Q7WG25 7.1e-24 95 37 4 150 3 def2 Peptide deformylase 2 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q9XAQ2 9.23e-24 95 35 4 158 3 def3 Peptide deformylase 3 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
A5FGV5 9.26e-24 95 33 4 178 3 def Peptide deformylase Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / BCRC 14874 / CCUG 350202 / NBRC 14942 / NCIMB 11054 / UW101)
A7NPM9 1.06e-23 94 38 5 154 3 def Peptide deformylase Roseiflexus castenholzii (strain DSM 13941 / HLO8)
B1I504 1.12e-23 94 33 3 155 3 def Peptide deformylase Desulforudis audaxviator (strain MP104C)
Q9FCA2 1.94e-23 94 33 3 154 3 def2 Peptide deformylase 2 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q051Q7 1.98e-23 94 35 4 164 3 def Peptide deformylase Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04RW4 1.98e-23 94 35 4 164 3 def Peptide deformylase Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
P63920 2.06e-23 93 35 2 165 3 def Peptide deformylase-like Brucella suis biovar 1 (strain 1330)
P63919 2.06e-23 93 35 2 165 3 BMEII0812 Peptide deformylase-like Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q7W4K0 2.49e-23 93 37 5 151 3 def2 Peptide deformylase 2 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7W0Q0 2.49e-23 93 37 5 151 3 def1 Peptide deformylase 1 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
A5US58 3.56e-23 93 38 8 174 3 def Peptide deformylase Roseiflexus sp. (strain RS-1)
Q8REF0 3.68e-23 93 35 4 164 3 def Peptide deformylase Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q8FMD0 4.62e-23 93 33 6 168 3 def2 Peptide deformylase 2 Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q88EA7 5.08e-23 92 38 4 151 3 def2 Peptide deformylase 2 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q89N37 5.64e-23 92 32 2 165 3 bll4005 Peptide deformylase-like Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q9PK41 1.04e-22 92 33 3 167 3 def Peptide deformylase Chlamydia muridarum (strain MoPn / Nigg)
Q9RRQ4 1.55e-22 92 35 5 168 3 def Peptide deformylase Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
P43522 2.08e-22 91 37 4 159 1 def Peptide deformylase Thermus thermophilus
Q5SLH2 2.08e-22 91 37 4 159 3 def Peptide deformylase Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q72H33 2.08e-22 91 37 4 159 3 def Peptide deformylase Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
A8LE21 2.48e-22 91 41 3 139 3 def Peptide deformylase Parafrankia sp. (strain EAN1pec)
A0QQP8 2.83e-22 91 33 4 168 3 def Peptide deformylase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
B2S3Z6 3.87e-22 90 39 3 140 3 def Peptide deformylase Treponema pallidum subsp. pallidum (strain SS14)
O83738 3.87e-22 90 39 3 140 3 def Peptide deformylase Treponema pallidum (strain Nichols)
Q8G487 4.5e-22 90 32 1 153 3 def2 Peptide deformylase 2 Bifidobacterium longum (strain NCC 2705)
A1T320 7.78e-22 90 34 3 147 3 def Peptide deformylase Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
Q8UF49 3.36e-21 87 34 4 163 3 Atu1550 Peptide deformylase-like Agrobacterium fabrum (strain C58 / ATCC 33970)
Q82IV0 3.65e-21 89 32 4 168 3 def1 Peptide deformylase 1 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
O84357 5.03e-21 87 34 3 167 3 def Peptide deformylase Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
B0BBY7 5.03e-21 87 34 3 167 3 def Peptide deformylase Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis)
Q3KM05 5.03e-21 87 34 3 167 3 def Peptide deformylase Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13)
B0B7S2 5.03e-21 87 34 3 167 3 def Peptide deformylase Chlamydia trachomatis serovar L2 (strain ATCC VR-902B / DSM 19102 / 434/Bu)
Q9K4A0 1.11e-20 87 34 3 144 3 def4 Peptide deformylase 4 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
A4T2T4 2.02e-20 86 31 4 167 3 def Peptide deformylase Mycolicibacterium gilvum (strain PYR-GCK)
Q73T03 2.69e-20 86 30 4 176 3 def Peptide deformylase Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Q9FUZ0 4.33e-20 87 34 6 176 2 PDF1A Peptide deformylase 1A, chloroplastic Solanum lycopersicum
Q9CBI2 5.09e-20 85 30 4 166 3 def Peptide deformylase Mycobacterium leprae (strain TN)
B8ZSF6 5.09e-20 85 30 4 166 3 def Peptide deformylase Mycobacterium leprae (strain Br4923)
Q9Z6J2 6.75e-20 85 34 4 167 3 def Peptide deformylase Chlamydia pneumoniae
B6RGY0 7.1e-20 86 36 4 159 2 PDF1A Peptide deformylase 1A, chloroplastic Oryza sativa subsp. japonica
Q8NM41 1.09e-19 84 34 4 146 3 def2 Peptide deformylase 2 Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
B2HQN4 1.26e-19 84 32 4 167 3 def Peptide deformylase Mycobacterium marinum (strain ATCC BAA-535 / M)
Q8PGV2 1.27e-19 84 38 5 143 3 def1 Peptide deformylase 1 Xanthomonas axonopodis pv. citri (strain 306)
Q886I1 1.41e-19 84 33 5 162 3 def2 Peptide deformylase 2 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
B1MIN9 1.88e-19 84 32 4 167 3 def Peptide deformylase Mycobacteroides abscessus (strain ATCC 19977 / DSM 44196 / CCUG 20993 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543 / L948)
A0PNK2 2.35e-19 84 32 4 167 3 def Peptide deformylase Mycobacterium ulcerans (strain Agy99)
Q1BEJ4 3.82e-19 83 31 4 176 3 def Peptide deformylase Mycobacterium sp. (strain MCS)
A1UAD9 3.82e-19 83 31 4 176 3 def Peptide deformylase Mycobacterium sp. (strain KMS)
A3PTZ4 3.82e-19 83 31 4 176 3 def Peptide deformylase Mycobacterium sp. (strain JLS)
B0SQM2 4.46e-19 82 32 4 164 3 def Peptide deformylase Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris)
B0SHH1 4.46e-19 82 32 4 164 3 def Peptide deformylase Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames)
Q8YVH1 5.52e-19 82 34 5 155 3 def2 Peptide deformylase 2 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
C1B0D9 2.41e-18 81 31 3 174 3 def Peptide deformylase Rhodococcus opacus (strain B4)
Q8XZJ6 2.41e-18 80 34 5 150 3 def2 Peptide deformylase 2 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q8PCN7 6.38e-18 79 37 5 143 3 def1 Peptide deformylase 1 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
P9WIJ3 6.44e-18 80 29 4 176 1 def Peptide deformylase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WIJ2 6.44e-18 80 29 4 176 3 def Peptide deformylase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5TZF5 6.44e-18 80 29 4 176 3 def Peptide deformylase Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1AKA5 6.44e-18 80 29 4 176 3 def Peptide deformylase Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KFQ1 6.44e-18 80 29 4 176 3 def Peptide deformylase Mycobacterium bovis (strain BCG / Pasteur 1173P2)
Q253S4 9.5e-18 79 34 3 167 3 def Peptide deformylase Chlamydia felis (strain Fe/C-56)
Q7NJV3 1.08e-17 80 38 3 155 3 def1 Peptide deformylase 1 Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q7U206 1.38e-17 79 30 4 166 3 def Peptide deformylase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q9FV53 3.75e-17 79 35 4 153 1 PDF1A Peptide deformylase 1A, chloroplastic/mitochondrial Arabidopsis thaliana
Q823U4 4.55e-17 77 33 3 167 3 def Peptide deformylase Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)
B8DCF7 1.6e-16 75 39 3 111 3 def Peptide deformylase Listeria monocytogenes serotype 4a (strain HCC23)
Q9HBH1 2.77e-16 76 31 4 157 1 PDF Peptide deformylase, mitochondrial Homo sapiens
A0AHG3 2.8e-16 75 39 3 111 3 def Peptide deformylase Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q5L6G8 3.76e-16 75 31 3 167 3 def Peptide deformylase Chlamydia abortus (strain DSM 27085 / S26/3)
Q9RD27 9.24e-16 74 33 4 157 3 def1 Peptide deformylase 1 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q825U9 1.36e-15 74 33 4 157 3 def3 Peptide deformylase 3 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q8Y866 1.72e-15 73 38 3 111 3 def Peptide deformylase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
S4R2K0 1.76e-15 74 32 4 155 3 Pdf Peptide deformylase, mitochondrial Mus musculus
Q721B5 1.89e-15 73 38 3 111 3 def Peptide deformylase Listeria monocytogenes serotype 4b (strain F2365)
C1L1X2 1.89e-15 73 38 3 111 3 def Peptide deformylase Listeria monocytogenes serotype 4b (strain CLIP80459)
Q03QL3 1.92e-15 73 37 4 114 3 def Peptide deformylase Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q92CX8 2.41e-15 72 37 3 111 3 def Peptide deformylase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q8CPI9 3.24e-15 72 32 2 132 3 SE_0890 Peptide deformylase-like Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HPX6 3.24e-15 72 32 2 132 3 SERP0781 Peptide deformylase-like Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q1WU76 3.57e-15 72 33 6 157 3 def Peptide deformylase Ligilactobacillus salivarius (strain UCC118)
P47352 4.52e-15 72 28 8 167 3 def Peptide deformylase Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q81MQ9 1.13e-14 71 36 3 111 3 def2 Peptide deformylase 2 Bacillus anthracis
Q45495 1.48e-14 70 31 6 154 1 defB Peptide deformylase 2 Bacillus subtilis (strain 168)
Q819K2 1.94e-14 70 36 3 111 1 def2 Peptide deformylase 2 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q9PQ25 3.5e-14 70 36 4 112 3 def Peptide deformylase Ureaplasma parvum serovar 3 (strain ATCC 700970)
B1AJA6 3.5e-14 70 36 4 112 3 def Peptide deformylase Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736)
Q9K9I9 4.15e-14 69 36 6 121 3 def Peptide deformylase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
B9EB04 5.66e-14 69 31 5 148 3 def Peptide deformylase Macrococcus caseolyticus (strain JCSC5402)
A4VXS1 7.08e-14 69 37 4 126 3 def Peptide deformylase Streptococcus suis (strain 05ZYH33)
A4W418 7.08e-14 69 37 4 126 3 def Peptide deformylase Streptococcus suis (strain 98HAH33)
B2G6P1 1.25e-13 68 30 5 155 3 def Peptide deformylase Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A5VJ71 1.25e-13 68 30 5 155 3 def Peptide deformylase Limosilactobacillus reuteri (strain DSM 20016)
Q8CPN4 1.38e-13 68 29 4 154 3 def Peptide deformylase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HQ78 1.38e-13 68 29 4 154 3 def Peptide deformylase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q5WFA2 1.48e-13 68 31 6 158 3 def Peptide deformylase Shouchella clausii (strain KSM-K16)
Q74JW2 2.98e-13 67 30 5 155 3 def Peptide deformylase Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q8EHZ2 3.86e-13 67 30 5 153 3 def2 Peptide deformylase 2 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q8NX19 5e-13 66 30 2 133 3 MW1098 Peptide deformylase-like Staphylococcus aureus (strain MW2)
Q6G9Z8 5e-13 66 30 2 133 3 SAS1149 Peptide deformylase-like Staphylococcus aureus (strain MSSA476)
Q6GHM0 5e-13 66 30 2 133 3 SAR1191 Peptide deformylase-like Staphylococcus aureus (strain MRSA252)
P63922 6.43e-13 66 29 2 133 3 SA1058 Peptide deformylase-like Staphylococcus aureus (strain N315)
P63921 6.43e-13 66 29 2 133 3 SAV1215 Peptide deformylase-like Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HGL7 6.43e-13 66 29 2 133 3 SACOL1227 Peptide deformylase-like Staphylococcus aureus (strain COL)
Q88VB2 6.68e-13 66 29 5 156 3 def Peptide deformylase Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q7V8G6 8.3e-13 66 33 6 160 3 def1 Peptide deformylase 1 Prochlorococcus marinus (strain MIT 9313)
Q8ER96 1.09e-12 65 33 3 112 3 def Peptide deformylase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
P68826 1.89e-12 65 33 3 112 1 def Peptide deformylase Staphylococcus aureus
P99077 1.89e-12 65 33 3 112 1 def Peptide deformylase Staphylococcus aureus (strain N315)
P68825 1.89e-12 65 33 3 112 3 def Peptide deformylase Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q8NX78 1.93e-12 65 33 3 112 3 def Peptide deformylase Staphylococcus aureus (strain MW2)
Q6GAC3 1.93e-12 65 33 3 112 3 def Peptide deformylase Staphylococcus aureus (strain MSSA476)
Q6GHZ4 1.93e-12 65 33 3 112 3 def Peptide deformylase Staphylococcus aureus (strain MRSA252)
Q5HGZ3 1.93e-12 65 33 3 112 1 def Peptide deformylase Staphylococcus aureus (strain COL)
Q82ZJ0 2.55e-12 65 33 3 115 1 def Peptide deformylase Enterococcus faecalis (strain ATCC 700802 / V583)
Q38WP3 3.13e-12 64 32 7 159 3 def Peptide deformylase Latilactobacillus sakei subsp. sakei (strain 23K)
B2GBA3 3.31e-12 64 30 4 152 3 def Peptide deformylase Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
O31410 5.79e-12 63 31 5 151 1 None Peptide deformylase 2 Geobacillus stearothermophilus
P75527 2.28e-11 63 31 4 106 3 def Peptide deformylase Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
A8YUR0 3.14e-11 62 29 5 158 3 def Peptide deformylase Lactobacillus helveticus (strain DPC 4571)
Q03F09 3.98e-11 61 29 6 156 3 def Peptide deformylase Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
Q83AK6 4.67e-11 62 33 3 114 3 def2 Peptide deformylase 2 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
Q92JI7 7.02e-11 61 32 4 136 3 def2 Peptide deformylase 2 Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q042S1 7.24e-11 61 29 5 155 3 def Peptide deformylase Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
Q8EVJ8 1.77e-10 60 26 6 168 3 def Peptide deformylase Malacoplasma penetrans (strain HF-2)
Q039N7 1.79e-10 60 32 6 155 3 def Peptide deformylase Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
B3WE13 1.79e-10 60 32 6 155 3 def Peptide deformylase Lacticaseibacillus casei (strain BL23)
Q48661 2.25e-10 60 30 5 141 3 def Peptide deformylase Lactococcus lactis subsp. lactis (strain IL1403)
O08450 4.2e-10 58 34 3 112 3 def Peptide deformylase Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
C1CF38 4.66e-10 59 31 3 128 3 def Peptide deformylase Streptococcus pneumoniae (strain JJA)
Q8DP79 4.66e-10 59 31 3 128 1 def Peptide deformylase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
B2IQS1 4.66e-10 59 31 3 128 3 def Peptide deformylase Streptococcus pneumoniae (strain CGSP14)
B8ZL02 4.66e-10 59 31 3 128 3 def Peptide deformylase Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
B1ICN7 4.66e-10 59 31 3 128 3 def Peptide deformylase Streptococcus pneumoniae (strain Hungary19A-6)
C1C851 4.66e-10 59 31 3 128 3 def Peptide deformylase Streptococcus pneumoniae (strain 70585)
Q04JP7 4.66e-10 59 31 3 128 3 def Peptide deformylase Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
C1CQR2 5.16e-10 58 31 3 128 3 def Peptide deformylase Streptococcus pneumoniae (strain Taiwan19F-14)
C1CLF5 5.16e-10 58 31 3 128 3 def Peptide deformylase Streptococcus pneumoniae (strain P1031)
Q9F2F0 5.16e-10 58 31 3 128 1 def Peptide deformylase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q8DXF6 5.97e-10 58 34 4 120 3 def Peptide deformylase Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E378 5.97e-10 58 34 4 120 1 def Peptide deformylase Streptococcus agalactiae serotype III (strain NEM316)
Q3JZ45 5.97e-10 58 34 4 120 3 def Peptide deformylase Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
B5XIL1 6.28e-10 58 32 4 130 3 def Peptide deformylase Streptococcus pyogenes serotype M49 (strain NZ131)
P0DC97 6.96e-10 58 32 4 130 3 def Peptide deformylase Streptococcus pyogenes serotype M3 (strain SSI-1)
Q48R93 6.96e-10 58 32 4 130 3 def Peptide deformylase Streptococcus pyogenes serotype M28 (strain MGAS6180)
A2RGI0 6.96e-10 58 32 4 130 3 def Peptide deformylase Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J4M3 6.96e-10 58 32 4 130 3 def Peptide deformylase Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JEV7 6.96e-10 58 32 4 130 3 def Peptide deformylase Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1JJW6 6.96e-10 58 32 4 130 3 def Peptide deformylase Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1J9R7 6.96e-10 58 32 4 130 3 def Peptide deformylase Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q5X9V1 6.96e-10 58 32 4 130 1 def Peptide deformylase Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DC96 6.96e-10 58 32 4 130 3 def Peptide deformylase Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P68771 6.96e-10 58 32 4 130 1 def Peptide deformylase Streptococcus pyogenes serotype M1
A8AV30 7.47e-10 58 32 4 120 3 def Peptide deformylase Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
Q8NZB7 7.62e-10 58 30 4 144 3 def Peptide deformylase Streptococcus pyogenes serotype M18 (strain MGAS8232)
C0MFA6 1.31e-09 58 32 4 132 3 def Peptide deformylase Streptococcus equi subsp. zooepidemicus (strain H70)
B5E5U9 2.97e-09 57 31 4 128 3 def Peptide deformylase Streptococcus pneumoniae serotype 19F (strain G54)
C0M9E1 3.43e-09 57 32 4 130 3 def Peptide deformylase Streptococcus equi subsp. equi (strain 4047)
B4U576 3.5e-09 57 33 4 121 3 def Peptide deformylase Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
Q1GAR4 5.98e-09 55 28 5 158 3 def Peptide deformylase Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
Q04B51 6.62e-09 55 28 5 158 3 def Peptide deformylase Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
B9DTD6 9.23e-09 55 30 4 129 3 def Peptide deformylase Streptococcus uberis (strain ATCC BAA-854 / 0140J)
Q98PN3 1.71e-08 54 31 5 127 3 def Peptide deformylase Mycoplasmopsis pulmonis (strain UAB CTIP)
Q8G534 2.75e-08 54 29 3 144 3 def1 Peptide deformylase 1 Bifidobacterium longum (strain NCC 2705)
Q8DWC2 4.02e-08 53 30 4 120 1 def Peptide deformylase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q82TW4 5.46e-08 53 30 3 139 3 def1 Peptide deformylase 1 Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q03MP6 7.41e-08 53 30 3 120 3 def Peptide deformylase Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q5M6B0 7.41e-08 53 30 3 120 3 def Peptide deformylase Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5M1R9 7.41e-08 53 30 3 120 3 def Peptide deformylase Streptococcus thermophilus (strain CNRZ 1066)
A1A2Z1 2.01e-07 52 30 3 130 3 def Peptide deformylase Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_19080
Feature type CDS
Gene def
Product peptide deformylase
Location 4117 - 4626 (strand: 1)
Length 510 (nucleotides) / 169 (amino acids)

Contig

Accession contig_38
Length 24827 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2366
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01327 Polypeptide deformylase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0242 Translation, ribosomal structure and biogenesis (J) J Peptide deformylase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K01462 peptide deformylase [EC:3.5.1.88] - -

Protein Sequence

MALLTVLHYPDERLRKIAKPVEKVDAGIQKIVDDMFETMYDEEGIGLAATQVDIHQRIIVIDVSEERNERLVLINPELLEKSGEAGIEEGCLSIPEQRAFVPRAEHVKIRALDYNGEPFELETGDLLAICIQHEMDHLEGKLFVDYLSAMKRQRIRQKVEKLDRLRARS

Flanking regions ( +/- flanking 50bp)

GAATAGACATTAATTTCCATCCATTTTTTAGATAGAACACGAAAAAATCTATGGCGTTATTAACTGTATTACATTATCCCGACGAGCGGCTTCGCAAGATTGCAAAGCCGGTTGAAAAAGTCGATGCCGGCATTCAGAAGATTGTCGATGATATGTTCGAAACCATGTACGACGAAGAAGGTATTGGTCTGGCAGCCACTCAGGTTGATATCCACCAGCGCATTATCGTGATTGATGTGTCAGAAGAGCGGAATGAGCGCCTGGTGCTGATCAACCCGGAACTGCTGGAAAAATCCGGAGAAGCCGGAATCGAAGAAGGTTGTTTATCGATTCCTGAGCAGCGGGCATTCGTACCGCGTGCCGAGCACGTTAAAATCCGGGCGCTGGACTATAACGGCGAGCCTTTCGAGCTGGAAACCGGCGATCTGCTGGCAATTTGTATCCAGCATGAAATGGATCACCTGGAAGGTAAATTATTTGTCGATTACCTTTCCGCTATGAAGCGCCAGCGCATCCGTCAGAAAGTCGAAAAACTGGACAGACTCAGAGCCCGGTCTTAATACCCGCAGTCTTTATCTGCCACAGACCGCAGTAGCGCACGGGCACTGTT