Homologs in group_3572

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_15305 EHELCC_15305 100.0 Morganella morganii S2 dicC DNA-binding transcriptional regulator DicC
NLDBIP_15835 NLDBIP_15835 100.0 Morganella morganii S4 dicC DNA-binding transcriptional regulator DicC
LHKJJB_16005 LHKJJB_16005 100.0 Morganella morganii S3 dicC DNA-binding transcriptional regulator DicC
HKOGLL_15125 HKOGLL_15125 100.0 Morganella morganii S5 dicC DNA-binding transcriptional regulator DicC

Distribution of the homologs in the orthogroup group_3572

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3572

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P06965 1.85e-06 43 34 1 67 4 dicC Repressor protein of division inhibition gene dicB Escherichia coli (strain K12)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_18730
Feature type CDS
Gene dicC
Product DNA-binding transcriptional regulator DicC
Location 25718 - 25924 (strand: -1)
Length 207 (nucleotides) / 68 (amino acids)

Contig

Accession contig_35
Length 30077 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3572
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Domains

PF14549 DNA-binding transcriptional regulator Cro

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K22302 transcriptional repressor of cell division inhibition gene dicB - -

Protein Sequence

MTTSEVESYFGDANKVADFFGITPEAFYQWKKRPGGLIPKSRAFEAACRTDGKLKFDPILYKQGTKTI

Flanking regions ( +/- flanking 50bp)

GATAACTTATATTTTAATATCTAATTTATCTTAGATTTGAGGGCGTGCTTATGACCACCAGCGAAGTTGAAAGCTATTTCGGAGATGCAAACAAGGTAGCTGATTTTTTTGGGATAACCCCTGAAGCATTTTACCAATGGAAGAAACGACCGGGAGGTTTGATCCCTAAAAGCAGAGCATTTGAAGCAGCCTGCCGTACTGACGGAAAGCTGAAGTTCGATCCAATCCTTTACAAGCAGGGTACCAAAACTATCTGACTTTGGTAACTACAACCCAACCTGAAAGCGAGTAGGCAATGAAAAACGAA