Homologs in group_3564

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_15210 EHELCC_15210 100.0 Morganella morganii S2 - Phage protein
NLDBIP_15740 NLDBIP_15740 100.0 Morganella morganii S4 - Phage protein
LHKJJB_16100 LHKJJB_16100 100.0 Morganella morganii S3 - Phage protein
HKOGLL_15220 HKOGLL_15220 100.0 Morganella morganii S5 - Phage protein

Distribution of the homologs in the orthogroup group_3564

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3564

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_18635
Feature type CDS
Gene -
Product Phage protein
Location 14542 - 14703 (strand: -1)
Length 162 (nucleotides) / 53 (amino acids)

Contig

Accession contig_35
Length 30077 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3564
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Protein Sequence

MKNILLDLTALTGFGAVLAGCYLKYGLPDSLVIGGSAMVIYSLAVAMRGKRAS

Flanking regions ( +/- flanking 50bp)

CCCGGTGACTTCCTTTCCTCTCTGGATCCTGACGAAGAAATTCTATTCCTATGAAAAATATACTTCTTGATCTCACTGCCCTGACAGGTTTCGGTGCGGTGCTGGCAGGCTGTTACCTGAAATACGGCCTGCCGGATTCCCTGGTGATTGGCGGGTCAGCAATGGTTATCTATTCACTGGCTGTGGCCATGAGGGGGAAACGTGCTTCTTGATGCATTATTCCGCGATACACCGACCAGTATTGAGAATCCGGCGGTACCCA