Homologs in group_3508

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_06390 EHELCC_06390 100.0 Morganella morganii S2 - Integrase catalytic domain-containing protein
NLDBIP_06710 NLDBIP_06710 100.0 Morganella morganii S4 - Integrase catalytic domain-containing protein
LHKJJB_19310 LHKJJB_19310 100.0 Morganella morganii S3 - Integrase catalytic domain-containing protein
HKOGLL_04680 HKOGLL_04680 100.0 Morganella morganii S5 - Integrase catalytic domain-containing protein

Distribution of the homologs in the orthogroup group_3508

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3508

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q06715 0.000814 38 34 1 67 4 None ATP-dependent protease Lactococcus lactis subsp. lactis

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_17945
Feature type CDS
Gene -
Product Integrase catalytic domain-containing protein
Location 26574 - 26780 (strand: 1)
Length 207 (nucleotides) / 68 (amino acids)

Contig

Accession contig_31
Length 36259 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3508
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Domains

PF13683 Integrase core domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2801 Mobilome: prophages, transposons (X) X Transposase InsO and inactivated derivatives

Protein Sequence

MERFFRSLKNEWMPVTGYTSFSEAAQAITGYIVGYYSELRPHEYNGGLPPNESENRYRKNSKTVASFS

Flanking regions ( +/- flanking 50bp)

ACCTCGCATATGCCAATCGCCGCTCTTGACATAGGAGCGTCAACAGTCCGATGGAGCGCTTTTTCAGGAGTCTGAAAAATGAGTGGATGCCGGTGACAGGCTACACCAGCTTCAGTGAAGCTGCTCAAGCGATAACGGGTTATATCGTCGGGTATTACAGCGAACTCAGGCCGCACGAATATAACGGTGGATTACCACCAAATGAATCGGAAAACCGATACCGAAAAAACTCTAAAACCGTGGCCAGTTTTAGTTGACCACTACAAAAGCTTATTGATGAACGAACTGATGATGTTTTGTATGGTGA