Homologs in group_2285

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_18040 EHELCC_18040 100.0 Morganella morganii S2 rplK 50S ribosomal protein L11
NLDBIP_18110 NLDBIP_18110 100.0 Morganella morganii S4 rplK 50S ribosomal protein L11
LHKJJB_18305 LHKJJB_18305 100.0 Morganella morganii S3 rplK 50S ribosomal protein L11
HKOGLL_17895 HKOGLL_17895 100.0 Morganella morganii S5 rplK 50S ribosomal protein L11
F4V73_RS14940 F4V73_RS14940 97.2 Morganella psychrotolerans rplK 50S ribosomal protein L11
PMI_RS13775 PMI_RS13775 93.7 Proteus mirabilis HI4320 rplK 50S ribosomal protein L11

Distribution of the homologs in the orthogroup group_2285

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2285

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P60103 2.76e-95 273 92 0 142 3 rplK Large ribosomal subunit protein uL11 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B4EYV3 3.01e-95 273 94 0 141 3 rplK Large ribosomal subunit protein uL11 Proteus mirabilis (strain HI4320)
C5BHE0 3.37e-94 271 93 0 141 3 rplK Large ribosomal subunit protein uL11 Edwardsiella ictaluri (strain 93-146)
P09763 4.79e-94 270 92 0 141 3 rplK Large ribosomal subunit protein uL11 Serratia marcescens
A8G8E3 4.84e-94 270 92 0 141 3 rplK Large ribosomal subunit protein uL11 Serratia proteamaculans (strain 568)
A9QZM4 5.65e-94 270 92 0 142 3 rplK Large ribosomal subunit protein uL11 Yersinia pestis bv. Antiqua (strain Angola)
B1JJJ4 1.79e-93 269 91 0 142 3 rplK Large ribosomal subunit protein uL11 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66FQ6 1.79e-93 269 91 0 142 3 rplK Large ribosomal subunit protein uL11 Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TS33 1.79e-93 269 91 0 142 3 rplK Large ribosomal subunit protein uL11 Yersinia pestis (strain Pestoides F)
Q1CN82 1.79e-93 269 91 0 142 3 rplK Large ribosomal subunit protein uL11 Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZAP1 1.79e-93 269 91 0 142 3 rplK Large ribosomal subunit protein uL11 Yersinia pestis
B2K108 1.79e-93 269 91 0 142 3 rplK Large ribosomal subunit protein uL11 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C1T7 1.79e-93 269 91 0 142 3 rplK Large ribosomal subunit protein uL11 Yersinia pestis bv. Antiqua (strain Antiqua)
A7FNI7 1.79e-93 269 91 0 142 3 rplK Large ribosomal subunit protein uL11 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
P10055 2.02e-93 269 94 0 141 3 rplK Large ribosomal subunit protein uL11 Proteus vulgaris
Q2NWS0 2.18e-93 269 92 0 141 3 rplK Large ribosomal subunit protein uL11 Sodalis glossinidius (strain morsitans)
A7MQQ0 5.13e-93 268 92 0 141 3 rplK Large ribosomal subunit protein uL11 Cronobacter sakazakii (strain ATCC BAA-894)
A8AKU4 6.74e-93 268 92 0 141 3 rplK Large ribosomal subunit protein uL11 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A1JIH6 7.61e-93 267 90 0 142 3 rplK Large ribosomal subunit protein uL11 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A6TGN5 8.49e-93 267 91 0 141 3 rplK Large ribosomal subunit protein uL11 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q3YV01 1.36e-92 267 91 0 141 3 rplK Large ribosomal subunit protein uL11 Shigella sonnei (strain Ss046)
Q0SY17 1.36e-92 267 91 0 141 3 rplK Large ribosomal subunit protein uL11 Shigella flexneri serotype 5b (strain 8401)
Q32AF5 1.36e-92 267 91 0 141 3 rplK Large ribosomal subunit protein uL11 Shigella dysenteriae serotype 1 (strain Sd197)
B2TWG9 1.36e-92 267 91 0 141 3 rplK Large ribosomal subunit protein uL11 Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
P0A7K0 1.36e-92 267 91 0 141 3 rplK Large ribosomal subunit protein uL11 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A7K1 1.36e-92 267 91 0 141 3 rplK Large ribosomal subunit protein uL11 Salmonella typhi
B4TQJ1 1.36e-92 267 91 0 141 3 rplK Large ribosomal subunit protein uL11 Salmonella schwarzengrund (strain CVM19633)
B5BJP9 1.36e-92 267 91 0 141 3 rplK Large ribosomal subunit protein uL11 Salmonella paratyphi A (strain AKU_12601)
C0Q2R3 1.36e-92 267 91 0 141 3 rplK Large ribosomal subunit protein uL11 Salmonella paratyphi C (strain RKS4594)
Q5PK81 1.36e-92 267 91 0 141 3 rplK Large ribosomal subunit protein uL11 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T0Y5 1.36e-92 267 91 0 141 3 rplK Large ribosomal subunit protein uL11 Salmonella newport (strain SL254)
B4TCS0 1.36e-92 267 91 0 141 3 rplK Large ribosomal subunit protein uL11 Salmonella heidelberg (strain SL476)
B5RFK5 1.36e-92 267 91 0 141 3 rplK Large ribosomal subunit protein uL11 Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QYD4 1.36e-92 267 91 0 141 3 rplK Large ribosomal subunit protein uL11 Salmonella enteritidis PT4 (strain P125109)
B5FQJ5 1.36e-92 267 91 0 141 3 rplK Large ribosomal subunit protein uL11 Salmonella dublin (strain CT_02021853)
Q57H73 1.36e-92 267 91 0 141 3 rplK Large ribosomal subunit protein uL11 Salmonella choleraesuis (strain SC-B67)
A9MHF7 1.36e-92 267 91 0 141 3 rplK Large ribosomal subunit protein uL11 Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5F0W3 1.36e-92 267 91 0 141 3 rplK Large ribosomal subunit protein uL11 Salmonella agona (strain SL483)
B7LUL9 1.36e-92 267 91 0 141 3 rplK Large ribosomal subunit protein uL11 Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1R5U7 1.36e-92 267 91 0 141 3 rplK Large ribosomal subunit protein uL11 Escherichia coli (strain UTI89 / UPEC)
B1LNT5 1.36e-92 267 91 0 141 3 rplK Large ribosomal subunit protein uL11 Escherichia coli (strain SMS-3-5 / SECEC)
B6I5J3 1.36e-92 267 91 0 141 3 rplK Large ribosomal subunit protein uL11 Escherichia coli (strain SE11)
B7NFS3 1.36e-92 267 91 0 141 3 rplK Large ribosomal subunit protein uL11 Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A7J7 1.36e-92 267 91 0 141 1 rplK Large ribosomal subunit protein uL11 Escherichia coli (strain K12)
B1IUR4 1.36e-92 267 91 0 141 3 rplK Large ribosomal subunit protein uL11 Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A7J8 1.36e-92 267 91 0 141 3 rplK Large ribosomal subunit protein uL11 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TA82 1.36e-92 267 91 0 141 3 rplK Large ribosomal subunit protein uL11 Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A8A782 1.36e-92 267 91 0 141 3 rplK Large ribosomal subunit protein uL11 Escherichia coli O9:H4 (strain HS)
B1XBY5 1.36e-92 267 91 0 141 3 rplK Large ribosomal subunit protein uL11 Escherichia coli (strain K12 / DH10B)
C5A0S3 1.36e-92 267 91 0 141 3 rplK Large ribosomal subunit protein uL11 Escherichia coli (strain K12 / MC4100 / BW2952)
B7M730 1.36e-92 267 91 0 141 3 rplK Large ribosomal subunit protein uL11 Escherichia coli O8 (strain IAI1)
B7MRA9 1.36e-92 267 91 0 141 3 rplK Large ribosomal subunit protein uL11 Escherichia coli O81 (strain ED1a)
B7NRR1 1.36e-92 267 91 0 141 3 rplK Large ribosomal subunit protein uL11 Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5Z079 1.36e-92 267 91 0 141 3 rplK Large ribosomal subunit protein uL11 Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A7J9 1.36e-92 267 91 0 141 3 rplK Large ribosomal subunit protein uL11 Escherichia coli O157:H7
B7LA74 1.36e-92 267 91 0 141 3 rplK Large ribosomal subunit protein uL11 Escherichia coli (strain 55989 / EAEC)
B7MIW9 1.36e-92 267 91 0 141 3 rplK Large ribosomal subunit protein uL11 Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UPD8 1.36e-92 267 91 0 141 3 rplK Large ribosomal subunit protein uL11 Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZUJ6 1.36e-92 267 91 0 141 3 rplK Large ribosomal subunit protein uL11 Escherichia coli O139:H28 (strain E24377A / ETEC)
B5XYF9 1.91e-92 266 91 0 141 3 rplK Large ribosomal subunit protein uL11 Klebsiella pneumoniae (strain 342)
C6DHR1 2.09e-92 266 91 0 141 3 rplK Large ribosomal subunit protein uL11 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
B2VG92 2.09e-92 266 90 0 141 3 rplK Large ribosomal subunit protein uL11 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q83PC3 3.35e-92 266 90 0 141 3 rplK Large ribosomal subunit protein uL11 Shigella flexneri
Q31U14 4.17e-92 266 90 0 141 3 rplK Large ribosomal subunit protein uL11 Shigella boydii serotype 4 (strain Sb227)
Q6DAN4 4.5e-92 265 90 0 141 3 rplK Large ribosomal subunit protein uL11 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A4W5A3 1.49e-90 261 89 0 141 3 rplK Large ribosomal subunit protein uL11 Enterobacter sp. (strain 638)
B0UUZ4 2.42e-89 258 87 0 142 3 rplK Large ribosomal subunit protein uL11 Histophilus somni (strain 2336)
Q0I0V2 2.42e-89 258 87 0 142 3 rplK Large ribosomal subunit protein uL11 Histophilus somni (strain 129Pt)
P60105 2.64e-89 258 87 0 142 3 rplK Large ribosomal subunit protein uL11 Vibrio vulnificus (strain YJ016)
Q65W46 6.5e-89 258 88 0 141 3 rplK Large ribosomal subunit protein uL11 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
P62440 7.33e-89 257 88 0 142 3 rplK Large ribosomal subunit protein uL11 Photobacterium profundum (strain SS9)
A7MXE5 1.18e-88 257 87 0 142 3 rplK Large ribosomal subunit protein uL11 Vibrio campbellii (strain ATCC BAA-1116)
Q9CK85 1.33e-88 257 87 0 141 3 rplK Large ribosomal subunit protein uL11 Pasteurella multocida (strain Pm70)
A5UH22 1.36e-88 257 87 0 141 3 rplK Large ribosomal subunit protein uL11 Haemophilus influenzae (strain PittGG)
P44351 1.53e-88 256 87 0 141 3 rplK Large ribosomal subunit protein uL11 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5U9X6 1.53e-88 256 87 0 141 3 rplK Large ribosomal subunit protein uL11 Haemophilus influenzae (strain PittEE)
Q4QN31 1.53e-88 256 87 0 141 3 rplK Large ribosomal subunit protein uL11 Haemophilus influenzae (strain 86-028NP)
B5FC92 1.73e-88 256 87 0 142 3 rplK Large ribosomal subunit protein uL11 Aliivibrio fischeri (strain MJ11)
Q5E232 1.73e-88 256 87 0 142 3 rplK Large ribosomal subunit protein uL11 Aliivibrio fischeri (strain ATCC 700601 / ES114)
A6VKC9 1.93e-88 256 87 0 141 3 rplK Large ribosomal subunit protein uL11 Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q8DD24 3.37e-88 256 86 0 142 3 rplK Large ribosomal subunit protein uL11 Vibrio vulnificus (strain CMCP6)
Q87KQ0 3.89e-88 256 86 0 142 3 rplK Large ribosomal subunit protein uL11 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B6ENR7 1.62e-87 254 85 0 142 3 rplK Large ribosomal subunit protein uL11 Aliivibrio salmonicida (strain LFI1238)
B8F7D2 3.64e-87 253 85 0 141 3 rplK Large ribosomal subunit protein uL11 Glaesserella parasuis serovar 5 (strain SH0165)
O32613 7.35e-87 252 85 0 141 3 rplK Large ribosomal subunit protein uL11 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
B3GYU4 7.35e-87 252 85 0 141 3 rplK Large ribosomal subunit protein uL11 Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N316 7.35e-87 252 85 0 141 3 rplK Large ribosomal subunit protein uL11 Actinobacillus pleuropneumoniae serotype 5b (strain L20)
C3LR56 2.09e-85 249 84 0 142 3 rplK Large ribosomal subunit protein uL11 Vibrio cholerae serotype O1 (strain M66-2)
Q9KV34 2.09e-85 249 84 0 142 3 rplK Large ribosomal subunit protein uL11 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F3P1 2.09e-85 249 84 0 142 3 rplK Large ribosomal subunit protein uL11 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
B0TM23 3.01e-82 241 83 0 141 3 rplK Large ribosomal subunit protein uL11 Shewanella halifaxensis (strain HAW-EB4)
B1KMZ4 1.61e-81 239 82 0 141 3 rplK Large ribosomal subunit protein uL11 Shewanella woodyi (strain ATCC 51908 / MS32)
A8GYW5 1.61e-81 239 82 0 141 3 rplK Large ribosomal subunit protein uL11 Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
A1S207 2.76e-81 238 81 0 141 3 rplK Large ribosomal subunit protein uL11 Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
A3Q971 3.18e-81 238 82 0 141 3 rplK Large ribosomal subunit protein uL11 Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q0I0B6 1.09e-80 237 80 0 142 3 rplK Large ribosomal subunit protein uL11 Shewanella sp. (strain MR-7)
Q0HNU8 1.09e-80 237 80 0 142 3 rplK Large ribosomal subunit protein uL11 Shewanella sp. (strain MR-4)
A0KRL3 1.09e-80 237 80 0 142 3 rplK Large ribosomal subunit protein uL11 Shewanella sp. (strain ANA-3)
Q8EK78 1.11e-80 237 80 0 142 3 rplK Large ribosomal subunit protein uL11 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A8G1F9 1.12e-80 237 82 0 141 3 rplK Large ribosomal subunit protein uL11 Shewanella sediminis (strain HAW-EB3)
A1REA3 1.17e-80 236 80 0 141 3 rplK Large ribosomal subunit protein uL11 Shewanella sp. (strain W3-18-1)
A4YBZ4 1.17e-80 236 80 0 141 3 rplK Large ribosomal subunit protein uL11 Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q089R5 1.28e-80 236 81 0 141 3 rplK Large ribosomal subunit protein uL11 Shewanella frigidimarina (strain NCIMB 400)
B8CNC1 2.73e-80 236 81 0 141 3 rplK Large ribosomal subunit protein uL11 Shewanella piezotolerans (strain WP3 / JCM 13877)
Q8KA66 4.01e-79 233 76 0 141 3 rplK Large ribosomal subunit protein uL11 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
A9KW91 9.75e-79 232 80 0 141 3 rplK Large ribosomal subunit protein uL11 Shewanella baltica (strain OS195)
A6WHR7 9.75e-79 232 80 0 141 3 rplK Large ribosomal subunit protein uL11 Shewanella baltica (strain OS185)
B8EBL6 9.75e-79 232 80 0 141 3 rplK Large ribosomal subunit protein uL11 Shewanella baltica (strain OS223)
A1TYI6 1.65e-78 231 78 0 142 3 rplK Large ribosomal subunit protein uL11 Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q1LSY1 1.9e-78 231 76 0 142 3 rplK Large ribosomal subunit protein uL11 Baumannia cicadellinicola subsp. Homalodisca coagulata
Q12SX0 1.71e-77 229 79 0 141 3 rplK Large ribosomal subunit protein uL11 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
C4K4F5 2.15e-77 228 80 0 141 3 rplK Large ribosomal subunit protein uL11 Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
C4LBV6 8.65e-77 227 77 0 142 3 rplK Large ribosomal subunit protein uL11 Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
B8D6V4 9.04e-77 227 72 0 142 3 rplK Large ribosomal subunit protein uL11 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57150 9.04e-77 227 72 0 142 3 rplK Large ribosomal subunit protein uL11 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D8K0 9.04e-77 227 72 0 142 3 rplK Large ribosomal subunit protein uL11 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
A4SHU5 1.26e-76 226 78 0 141 3 rplK Large ribosomal subunit protein uL11 Aeromonas salmonicida (strain A449)
A0KQA9 1.26e-76 226 78 0 141 3 rplK Large ribosomal subunit protein uL11 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q1R0I6 2.1e-76 226 77 0 142 3 rplK Large ribosomal subunit protein uL11 Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q47UV5 2.95e-76 226 76 0 141 3 rplK Large ribosomal subunit protein uL11 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
B8GV69 3.68e-75 223 75 0 142 3 rplK Large ribosomal subunit protein uL11 Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q0ABI6 1.18e-74 221 75 0 142 3 rplK Large ribosomal subunit protein uL11 Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q60A10 2.45e-74 221 74 0 142 3 rplK Large ribosomal subunit protein uL11 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q0VSM6 4.02e-74 220 74 0 142 3 rplK Large ribosomal subunit protein uL11 Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q5QWA9 6.16e-74 219 74 0 142 3 rplK Large ribosomal subunit protein uL11 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q3J8Q3 8.38e-74 219 71 0 142 3 rplK Large ribosomal subunit protein uL11 Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
A4XZA1 1.01e-73 219 74 0 142 3 rplK Large ribosomal subunit protein uL11 Pseudomonas mendocina (strain ymp)
Q9HWC5 1.07e-73 219 73 0 142 1 rplK Large ribosomal subunit protein uL11 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02T91 1.07e-73 219 73 0 142 3 rplK Large ribosomal subunit protein uL11 Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V633 1.07e-73 219 73 0 142 3 rplK Large ribosomal subunit protein uL11 Pseudomonas aeruginosa (strain LESB58)
A6UZH7 1.07e-73 219 73 0 142 3 rplK Large ribosomal subunit protein uL11 Pseudomonas aeruginosa (strain PA7)
Q3ILQ4 1.08e-73 219 74 0 141 3 rplK Large ribosomal subunit protein uL11 Pseudoalteromonas translucida (strain TAC 125)
Q2S901 3.33e-73 218 73 0 141 3 rplK Large ribosomal subunit protein uL11 Hahella chejuensis (strain KCTC 2396)
A5EX74 4.24e-73 218 73 0 141 3 rplK Large ribosomal subunit protein uL11 Dichelobacter nodosus (strain VCS1703A)
C1DKK1 6.16e-73 217 72 0 142 3 rplK Large ribosomal subunit protein uL11 Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q31IZ3 8.1e-73 217 73 0 142 3 rplK Large ribosomal subunit protein uL11 Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q15YB5 1.34e-72 216 75 0 142 3 rplK Large ribosomal subunit protein uL11 Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
A4VHL9 3.23e-72 215 72 0 142 3 rplK Large ribosomal subunit protein uL11 Stutzerimonas stutzeri (strain A1501)
A6W3A3 5.52e-72 215 73 0 142 3 rplK Large ribosomal subunit protein uL11 Marinomonas sp. (strain MWYL1)
Q492B5 5.96e-72 214 72 0 139 3 rplK Large ribosomal subunit protein uL11 Blochmanniella pennsylvanica (strain BPEN)
Q21M97 6.37e-72 214 72 0 142 3 rplK Large ribosomal subunit protein uL11 Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q9PA82 8.1e-72 214 71 0 142 3 rplK Large ribosomal subunit protein uL11 Xylella fastidiosa (strain 9a5c)
C5BPQ2 1.07e-71 214 71 0 142 3 rplK Large ribosomal subunit protein uL11 Teredinibacter turnerae (strain ATCC 39867 / T7901)
Q87A28 1.51e-71 214 70 0 142 3 rplK Large ribosomal subunit protein uL11 Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B1JE13 1.67e-71 213 71 0 142 3 rplK Large ribosomal subunit protein uL11 Pseudomonas putida (strain W619)
Q88QP5 1.67e-71 213 71 0 142 3 rplK Large ribosomal subunit protein uL11 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KK56 1.67e-71 213 71 0 142 3 rplK Large ribosomal subunit protein uL11 Pseudomonas putida (strain GB-1)
A5VXN6 1.67e-71 213 71 0 142 3 rplK Large ribosomal subunit protein uL11 Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q3K5X7 2.92e-71 213 71 0 142 3 rplK Large ribosomal subunit protein uL11 Pseudomonas fluorescens (strain Pf0-1)
B3PK26 3.05e-71 213 71 0 142 3 rplK Large ribosomal subunit protein uL11 Cellvibrio japonicus (strain Ueda107)
Q1IFX7 3.3e-71 213 71 0 142 3 rplK Large ribosomal subunit protein uL11 Pseudomonas entomophila (strain L48)
Q47JB4 4.34e-71 213 70 0 142 3 rplK Large ribosomal subunit protein uL11 Dechloromonas aromatica (strain RCB)
C3K2Y7 5.28e-71 212 71 0 142 3 rplK Large ribosomal subunit protein uL11 Pseudomonas fluorescens (strain SBW25)
Q4K522 5.28e-71 212 71 0 142 3 rplK Large ribosomal subunit protein uL11 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
P60100 5.76e-70 209 71 0 142 3 rplK Large ribosomal subunit protein uL11 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q4ZMN3 6.09e-70 209 71 0 142 3 rplK Large ribosomal subunit protein uL11 Pseudomonas syringae pv. syringae (strain B728a)
Q889Y2 6.09e-70 209 71 0 142 3 rplK Large ribosomal subunit protein uL11 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q89B16 6.72e-70 209 66 0 140 3 rplK Large ribosomal subunit protein uL11 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
A1WVD3 7.83e-70 209 71 0 142 3 rplK Large ribosomal subunit protein uL11 Halorhodospira halophila (strain DSM 244 / SL1)
B2FQ34 1.02e-69 209 69 0 142 3 rplK Large ribosomal subunit protein uL11 Stenotrophomonas maltophilia (strain K279a)
B4SKV2 1.02e-69 209 69 0 142 3 rplK Large ribosomal subunit protein uL11 Stenotrophomonas maltophilia (strain R551-3)
Q48D25 1.11e-69 209 71 0 142 3 rplK Large ribosomal subunit protein uL11 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
A1KB38 1.8e-69 208 69 0 142 3 rplK Large ribosomal subunit protein uL11 Azoarcus sp. (strain BH72)
Q3SF21 2.17e-69 208 71 0 142 3 rplK Large ribosomal subunit protein uL11 Thiobacillus denitrificans (strain ATCC 25259)
Q5P343 2.17e-69 208 69 0 142 3 rplK Large ribosomal subunit protein uL11 Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
A9M3X8 2.45e-69 208 70 0 142 3 rplK Large ribosomal subunit protein uL11 Neisseria meningitidis serogroup C (strain 053442)
A9IJ32 2.79e-69 208 69 0 142 3 rplK Large ribosomal subunit protein uL11 Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Q6FF94 4.43e-69 207 70 0 141 3 rplK Large ribosomal subunit protein uL11 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
B0VDG6 5.95e-69 207 70 0 141 3 rplK Large ribosomal subunit protein uL11 Acinetobacter baumannii (strain AYE)
A3M1F9 5.95e-69 207 70 0 141 3 rplK Large ribosomal subunit protein uL11 Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B0VMA3 5.95e-69 207 70 0 141 3 rplK Large ribosomal subunit protein uL11 Acinetobacter baumannii (strain SDF)
B2I1Y7 5.95e-69 207 70 0 141 3 rplK Large ribosomal subunit protein uL11 Acinetobacter baumannii (strain ACICU)
B7I356 5.95e-69 207 70 0 141 3 rplK Large ribosomal subunit protein uL11 Acinetobacter baumannii (strain AB0057)
B7H1K2 5.95e-69 207 70 0 141 3 rplK Large ribosomal subunit protein uL11 Acinetobacter baumannii (strain AB307-0294)
Q8PNT4 6.86e-69 207 67 0 142 3 rplK Large ribosomal subunit protein uL11 Xanthomonas axonopodis pv. citri (strain 306)
Q5GWS1 7.91e-69 207 66 0 142 3 rplK Large ribosomal subunit protein uL11 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SQP7 7.91e-69 207 66 0 142 3 rplK Large ribosomal subunit protein uL11 Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2NZX4 7.91e-69 207 66 0 142 3 rplK Large ribosomal subunit protein uL11 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q3BWZ5 8.83e-69 207 67 0 142 3 rplK Large ribosomal subunit protein uL11 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
B4RQV8 9.85e-69 206 69 0 142 3 rplK Large ribosomal subunit protein uL11 Neisseria gonorrhoeae (strain NCCP11945)
Q5F5R1 9.85e-69 206 69 0 142 3 rplK Large ribosomal subunit protein uL11 Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q1H4P8 1.2e-68 206 69 0 142 3 rplK Large ribosomal subunit protein uL11 Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
A1KRG2 1.69e-68 206 69 0 142 3 rplK Large ribosomal subunit protein uL11 Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q9JX02 1.69e-68 206 69 0 142 3 rplK Large ribosomal subunit protein uL11 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A5WH39 1.7e-68 206 70 0 142 3 rplK Large ribosomal subunit protein uL11 Psychrobacter sp. (strain PRwf-1)
B0RU93 1.72e-68 206 69 0 142 3 rplK Large ribosomal subunit protein uL11 Xanthomonas campestris pv. campestris (strain B100)
B2UF71 1.74e-68 206 67 0 142 3 rplK Large ribosomal subunit protein uL11 Ralstonia pickettii (strain 12J)
Q9K1J3 1.94e-68 206 69 0 142 3 rplK Large ribosomal subunit protein uL11 Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q7W2H3 1.97e-68 206 68 0 142 3 rplK Large ribosomal subunit protein uL11 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WRE3 1.97e-68 206 68 0 142 3 rplK Large ribosomal subunit protein uL11 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q5WZM3 2.08e-68 206 74 0 142 3 rplK Large ribosomal subunit protein uL11 Legionella pneumophila (strain Lens)
Q5ZYQ4 2.08e-68 206 74 0 142 3 rplK Large ribosomal subunit protein uL11 Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A5IHS5 2.08e-68 206 74 0 142 3 rplK Large ribosomal subunit protein uL11 Legionella pneumophila (strain Corby)
Q5X870 2.08e-68 206 74 0 142 3 rplK Large ribosomal subunit protein uL11 Legionella pneumophila (strain Paris)
Q2L2N9 2.15e-68 206 69 0 142 3 rplK Large ribosomal subunit protein uL11 Bordetella avium (strain 197N)
Q8XUZ4 2.29e-68 206 67 0 142 3 rplK Large ribosomal subunit protein uL11 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q7W0S3 2.76e-68 205 68 0 142 3 rplK Large ribosomal subunit protein uL11 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q2SU15 4.37e-68 205 68 0 142 3 rplK Large ribosomal subunit protein uL11 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q63PZ9 4.37e-68 205 68 0 142 3 rplK Large ribosomal subunit protein uL11 Burkholderia pseudomallei (strain K96243)
A3NEJ1 4.37e-68 205 68 0 142 3 rplK Large ribosomal subunit protein uL11 Burkholderia pseudomallei (strain 668)
Q3JMP9 4.37e-68 205 68 0 142 3 rplK Large ribosomal subunit protein uL11 Burkholderia pseudomallei (strain 1710b)
A3P0C9 4.37e-68 205 68 0 142 3 rplK Large ribosomal subunit protein uL11 Burkholderia pseudomallei (strain 1106a)
A1V8B6 4.37e-68 205 68 0 142 3 rplK Large ribosomal subunit protein uL11 Burkholderia mallei (strain SAVP1)
Q62GJ3 4.37e-68 205 68 0 142 3 rplK Large ribosomal subunit protein uL11 Burkholderia mallei (strain ATCC 23344)
A2S7G2 4.37e-68 205 68 0 142 3 rplK Large ribosomal subunit protein uL11 Burkholderia mallei (strain NCTC 10229)
A3MRU1 4.37e-68 205 68 0 142 3 rplK Large ribosomal subunit protein uL11 Burkholderia mallei (strain NCTC 10247)
B3R7U0 8.35e-68 204 67 0 142 3 rplK Large ribosomal subunit protein uL11 Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q0K602 8.35e-68 204 67 0 142 3 rplK Large ribosomal subunit protein uL11 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q1LI16 8.35e-68 204 67 0 142 3 rplK Large ribosomal subunit protein uL11 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q8RTJ5 8.73e-68 204 68 0 142 3 rplK Large ribosomal subunit protein uL11 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4URC8 8.73e-68 204 68 0 142 3 rplK Large ribosomal subunit protein uL11 Xanthomonas campestris pv. campestris (strain 8004)
B5ELW8 8.92e-68 204 68 0 142 3 rplK Large ribosomal subunit protein uL11 Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J455 8.92e-68 204 68 0 142 3 rplK Large ribosomal subunit protein uL11 Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
B2JIH8 9.32e-68 204 67 0 142 3 rplK Large ribosomal subunit protein uL11 Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q46WD0 1.15e-67 204 67 0 142 3 rplK Large ribosomal subunit protein uL11 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
C1DAQ6 2.05e-67 203 67 0 142 3 rplK Large ribosomal subunit protein uL11 Laribacter hongkongensis (strain HLHK9)
A9ADI1 2.67e-67 203 67 0 142 3 rplK Large ribosomal subunit protein uL11 Burkholderia multivorans (strain ATCC 17616 / 249)
Q13TF8 2.79e-67 203 66 0 142 3 rplK Large ribosomal subunit protein uL11 Paraburkholderia xenovorans (strain LB400)
A4SUV0 6.85e-67 202 66 0 142 3 rplK Large ribosomal subunit protein uL11 Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
A4JAM8 1.03e-66 201 66 0 142 3 rplK Large ribosomal subunit protein uL11 Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q0BJ58 1.03e-66 201 66 0 142 3 rplK Large ribosomal subunit protein uL11 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B1YRB8 1.03e-66 201 66 0 142 3 rplK Large ribosomal subunit protein uL11 Burkholderia ambifaria (strain MC40-6)
C6C175 1.03e-66 201 72 1 140 3 rplK Large ribosomal subunit protein uL11 Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
Q4FQG9 1.07e-66 201 67 0 142 3 rplK Large ribosomal subunit protein uL11 Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q1BRT6 1.13e-66 201 66 0 142 3 rplK Large ribosomal subunit protein uL11 Burkholderia orbicola (strain AU 1054)
B1JU10 1.13e-66 201 66 0 142 3 rplK Large ribosomal subunit protein uL11 Burkholderia orbicola (strain MC0-3)
Q39KH9 1.13e-66 201 66 0 142 3 rplK Large ribosomal subunit protein uL11 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
B4E5A8 1.13e-66 201 66 0 142 3 rplK Large ribosomal subunit protein uL11 Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A0K3L3 1.13e-66 201 66 0 142 3 rplK Large ribosomal subunit protein uL11 Burkholderia cenocepacia (strain HI2424)
Q3A6Q8 1.59e-66 201 73 1 138 3 rplK Large ribosomal subunit protein uL11 Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
B2T763 1.72e-66 201 66 0 142 3 rplK Large ribosomal subunit protein uL11 Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
A1ALT0 2.1e-66 201 71 1 138 3 rplK Large ribosomal subunit protein uL11 Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
C5CKE9 3.47e-66 200 66 0 142 3 rplK Large ribosomal subunit protein uL11 Variovorax paradoxus (strain S110)
C6E4R8 3.51e-66 200 72 1 138 3 rplK Large ribosomal subunit protein uL11 Geobacter sp. (strain M21)
B5EFN9 3.51e-66 200 72 1 138 3 rplK Large ribosomal subunit protein uL11 Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
A9BR94 3.87e-66 200 67 0 142 3 rplK Large ribosomal subunit protein uL11 Delftia acidovorans (strain DSM 14801 / SPH-1)
A2SLG9 4.13e-66 200 66 0 142 3 rplK Large ribosomal subunit protein uL11 Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
Q1Q8P5 4.18e-66 200 66 0 142 3 rplK Large ribosomal subunit protein uL11 Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q123F9 8.33e-66 199 66 0 142 3 rplK Large ribosomal subunit protein uL11 Polaromonas sp. (strain JS666 / ATCC BAA-500)
B9M6V6 1.18e-65 199 70 1 138 3 rplK Large ribosomal subunit protein uL11 Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
P62434 1.35e-65 199 70 1 138 3 rplK Large ribosomal subunit protein uL11 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
B1XSE8 1.52e-65 198 65 0 142 3 rplK Large ribosomal subunit protein uL11 Polynucleobacter necessarius subsp. necessarius (strain STIR1)
A4G9U9 4.04e-65 197 66 0 142 3 rplK Large ribosomal subunit protein uL11 Herminiimonas arsenicoxydans
Q83ET4 4.6e-65 197 67 1 143 3 rplK Large ribosomal subunit protein uL11 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NAL0 4.6e-65 197 67 1 143 3 rplK Large ribosomal subunit protein uL11 Coxiella burnetii (strain RSA 331 / Henzerling II)
B6J275 4.6e-65 197 67 1 143 3 rplK Large ribosomal subunit protein uL11 Coxiella burnetii (strain CbuG_Q212)
B6J5B8 4.6e-65 197 67 1 143 3 rplK Large ribosomal subunit protein uL11 Coxiella burnetii (strain CbuK_Q154)
A6T3L7 5.73e-65 197 64 0 142 3 rplK Large ribosomal subunit protein uL11 Janthinobacterium sp. (strain Marseille)
Q0AF49 6.76e-65 197 66 0 142 3 rplK Large ribosomal subunit protein uL11 Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
A9KD43 6.98e-65 197 66 1 143 3 rplK Large ribosomal subunit protein uL11 Coxiella burnetii (strain Dugway 5J108-111)
B3E7S4 8.99e-65 196 69 2 142 3 rplK Large ribosomal subunit protein uL11 Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
Q82T71 9.91e-65 196 66 0 142 3 rplK Large ribosomal subunit protein uL11 Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
C4XIP3 1.2e-64 196 70 1 138 3 rplK Large ribosomal subunit protein uL11 Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
Q2IXS8 1.22e-64 196 66 0 142 3 rplK Large ribosomal subunit protein uL11 Rhodopseudomonas palustris (strain HaA2)
Q2YB09 1.52e-64 196 65 0 142 3 rplK Large ribosomal subunit protein uL11 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
A1VTG2 1.95e-64 196 65 0 142 3 rplK Large ribosomal subunit protein uL11 Polaromonas naphthalenivorans (strain CJ2)
Q9KGE6 2.52e-64 195 69 1 141 3 rplK1 Large ribosomal subunit protein uL11A Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q03E48 2.69e-64 195 69 1 142 3 rplK Large ribosomal subunit protein uL11 Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
A1AX79 2.93e-64 195 64 0 142 3 rplK Large ribosomal subunit protein uL11 Ruthia magnifica subsp. Calyptogena magnifica
B3QC05 3.61e-64 195 66 0 142 3 rplK Large ribosomal subunit protein uL11 Rhodopseudomonas palustris (strain TIE-1)
P62441 3.61e-64 195 66 0 142 1 rplK Large ribosomal subunit protein uL11 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
A5GAX7 3.7e-64 195 67 1 140 3 rplK Large ribosomal subunit protein uL11 Geotalea uraniireducens (strain Rf4)
Q21SF3 6.04e-64 194 63 0 142 3 rplK Large ribosomal subunit protein uL11 Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
B4R8K1 7.36e-64 194 66 0 140 3 rplK Large ribosomal subunit protein uL11 Phenylobacterium zucineum (strain HLK1)
P36254 1.06e-63 194 69 1 141 3 rplK Large ribosomal subunit protein uL11 Staphylococcus carnosus (strain TM300)
Q134R3 1.21e-63 194 64 0 142 3 rplK Large ribosomal subunit protein uL11 Rhodopseudomonas palustris (strain BisB5)
Q11HA9 1.26e-63 194 65 0 142 3 rplK Large ribosomal subunit protein uL11 Chelativorans sp. (strain BNC1)
Q8D237 1.36e-63 193 60 0 141 3 rplK Large ribosomal subunit protein uL11 Wigglesworthia glossinidia brevipalpis
Q211C4 1.66e-63 193 66 0 142 3 rplK Large ribosomal subunit protein uL11 Rhodopseudomonas palustris (strain BisB18)
B4S493 2.11e-63 193 68 1 141 3 rplK Large ribosomal subunit protein uL11 Prosthecochloris aestuarii (strain DSM 271 / SK 413)
Q5HID8 2.23e-63 193 69 1 141 3 rplK Large ribosomal subunit protein uL11 Staphylococcus aureus (strain COL)
P0A0F3 2.28e-63 193 69 1 141 3 rplK Large ribosomal subunit protein uL11 Staphylococcus aureus (strain MW2)
A8YZN5 2.28e-63 193 69 1 141 3 rplK Large ribosomal subunit protein uL11 Staphylococcus aureus (strain USA300 / TCH1516)
Q6GBV0 2.28e-63 193 69 1 141 3 rplK Large ribosomal subunit protein uL11 Staphylococcus aureus (strain MSSA476)
Q6GJD1 2.28e-63 193 69 1 141 3 rplK Large ribosomal subunit protein uL11 Staphylococcus aureus (strain MRSA252)
P0A0F2 2.28e-63 193 69 1 141 1 rplK Large ribosomal subunit protein uL11 Staphylococcus aureus (strain N315)
P0A0F1 2.28e-63 193 69 1 141 3 rplK Large ribosomal subunit protein uL11 Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5IQ91 2.28e-63 193 69 1 141 3 rplK Large ribosomal subunit protein uL11 Staphylococcus aureus (strain JH9)
P0A0F4 2.28e-63 193 69 1 141 3 rplK Large ribosomal subunit protein uL11 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FJA3 2.28e-63 193 69 1 141 3 rplK Large ribosomal subunit protein uL11 Staphylococcus aureus (strain USA300)
A6TZ14 2.28e-63 193 69 1 141 3 rplK Large ribosomal subunit protein uL11 Staphylococcus aureus (strain JH1)
A7WYW0 2.28e-63 193 69 1 141 3 rplK Large ribosomal subunit protein uL11 Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q8ETZ3 2.41e-63 193 68 1 141 3 rplK Large ribosomal subunit protein uL11 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q2YSC4 2.46e-63 193 69 1 141 3 rplK Large ribosomal subunit protein uL11 Staphylococcus aureus (strain bovine RF122 / ET3-1)
B1Y7H7 3.13e-63 192 64 0 142 3 rplK Large ribosomal subunit protein uL11 Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
Q4L3J6 3.2e-63 192 68 1 141 3 rplK Large ribosomal subunit protein uL11 Staphylococcus haemolyticus (strain JCSC1435)
Q8CTT5 3.2e-63 192 68 1 141 3 rplK Large ribosomal subunit protein uL11 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HRL5 3.2e-63 192 68 1 141 3 rplK Large ribosomal subunit protein uL11 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
A4IW95 3.27e-63 192 67 0 140 3 rplK Large ribosomal subunit protein uL11 Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NID6 3.27e-63 192 67 0 140 3 rplK Large ribosomal subunit protein uL11 Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
A0Q871 3.27e-63 192 67 0 140 3 rplK Large ribosomal subunit protein uL11 Francisella tularensis subsp. novicida (strain U112)
B2SFD2 3.27e-63 192 67 0 140 3 rplK Large ribosomal subunit protein uL11 Francisella tularensis subsp. mediasiatica (strain FSC147)
Q14JT9 3.27e-63 192 67 0 140 3 rplK Large ribosomal subunit protein uL11 Francisella tularensis subsp. tularensis (strain FSC 198)
C0ZIG5 3.49e-63 192 70 1 141 3 rplK Large ribosomal subunit protein uL11 Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
Q39Y17 3.49e-63 192 68 1 138 3 rplK Large ribosomal subunit protein uL11 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q5WLS5 3.61e-63 192 69 1 141 3 rplK Large ribosomal subunit protein uL11 Shouchella clausii (strain KSM-K16)
B6JER5 4.49e-63 192 65 0 142 3 rplK Large ribosomal subunit protein uL11 Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
A4YSH5 4.85e-63 192 64 0 142 3 rplK Large ribosomal subunit protein uL11 Bradyrhizobium sp. (strain ORS 278)
Q07KJ7 4.9e-63 192 64 0 142 3 rplK Large ribosomal subunit protein uL11 Rhodopseudomonas palustris (strain BisA53)
A5ELP2 5.01e-63 192 64 0 142 3 rplK Large ribosomal subunit protein uL11 Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
Q0BKC0 5.17e-63 192 67 0 140 3 rplK Large ribosomal subunit protein uL11 Francisella tularensis subsp. holarctica (strain OSU18)
Q2A1M3 5.17e-63 192 67 0 140 3 rplK Large ribosomal subunit protein uL11 Francisella tularensis subsp. holarctica (strain LVS)
A7NEC4 5.17e-63 192 67 0 140 3 rplK Large ribosomal subunit protein uL11 Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
B1YGT7 5.53e-63 192 68 1 141 3 rplK Large ribosomal subunit protein uL11 Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
A4XLK2 5.66e-63 192 68 1 141 3 rplK Large ribosomal subunit protein uL11 Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
Q38V05 5.78e-63 192 68 1 142 3 rplK Large ribosomal subunit protein uL11 Latilactobacillus sakei subsp. sakei (strain 23K)
A5CW29 6.88e-63 192 62 0 142 3 rplK Large ribosomal subunit protein uL11 Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
Q5L421 7.36e-63 192 68 1 141 3 rplK Large ribosomal subunit protein uL11 Geobacillus kaustophilus (strain HTA426)
A6X0A5 7.68e-63 192 66 0 142 3 rplK Large ribosomal subunit protein uL11 Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q8KG19 8.58e-63 191 66 1 142 3 rplK Large ribosomal subunit protein uL11 Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q18CE5 8.96e-63 191 70 1 141 3 rplK Large ribosomal subunit protein uL11 Clostridioides difficile (strain 630)
A5N4N5 9.26e-63 191 68 1 142 3 rplK Large ribosomal subunit protein uL11 Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B3QQS6 9.36e-63 191 66 1 142 3 rplK Large ribosomal subunit protein uL11 Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
A0LII0 1.09e-62 191 68 1 141 3 rplK Large ribosomal subunit protein uL11 Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
Q89J69 1.1e-62 191 64 0 142 3 rplK Large ribosomal subunit protein uL11 Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
C5D3Q4 1.33e-62 191 68 1 141 3 rplK Large ribosomal subunit protein uL11 Geobacillus sp. (strain WCH70)
A4IJH6 1.37e-62 191 68 1 141 3 rplK Large ribosomal subunit protein uL11 Geobacillus thermodenitrificans (strain NG80-2)
Q1GT67 1.42e-62 191 65 1 143 3 rplK Large ribosomal subunit protein uL11 Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
C4KZQ9 1.77e-62 191 67 1 141 3 rplK Large ribosomal subunit protein uL11 Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
B9MJX1 1.87e-62 191 67 1 141 3 rplK Large ribosomal subunit protein uL11 Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
A0PXT4 1.89e-62 191 68 1 141 3 rplK Large ribosomal subunit protein uL11 Clostridium novyi (strain NT)
Q88YX0 1.95e-62 191 68 1 142 3 rplK Large ribosomal subunit protein uL11 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q8G065 2.1e-62 191 66 0 142 3 rplK Large ribosomal subunit protein uL11 Brucella suis biovar 1 (strain 1330)
B0CH45 2.1e-62 191 66 0 142 3 rplK Large ribosomal subunit protein uL11 Brucella suis (strain ATCC 23445 / NCTC 10510)
Q8YHQ1 2.1e-62 191 66 0 142 3 rplK Large ribosomal subunit protein uL11 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RJL5 2.1e-62 191 66 0 142 3 rplK Large ribosomal subunit protein uL11 Brucella melitensis biotype 2 (strain ATCC 23457)
A9M5R4 2.1e-62 191 66 0 142 3 rplK Large ribosomal subunit protein uL11 Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q57CP4 2.1e-62 191 66 0 142 3 rplK Large ribosomal subunit protein uL11 Brucella abortus biovar 1 (strain 9-941)
Q2YM11 2.1e-62 191 66 0 142 3 rplK Large ribosomal subunit protein uL11 Brucella abortus (strain 2308)
B2S691 2.1e-62 191 66 0 142 3 rplK Large ribosomal subunit protein uL11 Brucella abortus (strain S19)
A1B011 2.42e-62 191 64 1 150 3 rplK Large ribosomal subunit protein uL11 Paracoccus denitrificans (strain Pd 1222)
A9VNB0 2.43e-62 190 68 1 141 3 rplK Large ribosomal subunit protein uL11 Bacillus mycoides (strain KBAB4)
Q6HPS1 2.43e-62 190 68 1 141 3 rplK Large ribosomal subunit protein uL11 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q63HA3 2.43e-62 190 68 1 141 3 rplK Large ribosomal subunit protein uL11 Bacillus cereus (strain ZK / E33L)
A7GK08 2.43e-62 190 68 1 141 3 rplK Large ribosomal subunit protein uL11 Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
B7HQT1 2.43e-62 190 68 1 141 3 rplK Large ribosomal subunit protein uL11 Bacillus cereus (strain AH187)
B7HJ35 2.43e-62 190 68 1 141 3 rplK Large ribosomal subunit protein uL11 Bacillus cereus (strain B4264)
C1ET26 2.43e-62 190 68 1 141 3 rplK Large ribosomal subunit protein uL11 Bacillus cereus (strain 03BB102)
B7IT06 2.43e-62 190 68 1 141 3 rplK Large ribosomal subunit protein uL11 Bacillus cereus (strain G9842)
P62431 2.43e-62 190 68 1 141 3 rplK Large ribosomal subunit protein uL11 Bacillus cereus (strain ATCC 10987 / NRS 248)
B7JKA5 2.43e-62 190 68 1 141 3 rplK Large ribosomal subunit protein uL11 Bacillus cereus (strain AH820)
Q81VU3 2.43e-62 190 68 1 141 3 rplK Large ribosomal subunit protein uL11 Bacillus anthracis
C3LJ69 2.43e-62 190 68 1 141 3 rplK Large ribosomal subunit protein uL11 Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P9P2 2.43e-62 190 68 1 141 3 rplK Large ribosomal subunit protein uL11 Bacillus anthracis (strain A0248)
A1TVT4 2.45e-62 190 64 0 142 3 rplK Large ribosomal subunit protein uL11 Paracidovorax citrulli (strain AAC00-1)
A1WK51 2.74e-62 190 64 0 142 3 rplK Large ribosomal subunit protein uL11 Verminephrobacter eiseniae (strain EF01-2)
A1WCN3 2.83e-62 190 64 0 142 3 rplK Large ribosomal subunit protein uL11 Acidovorax sp. (strain JS42)
B9MH51 2.83e-62 190 64 0 142 3 rplK Large ribosomal subunit protein uL11 Acidovorax ebreus (strain TPSY)
A5VR19 3.16e-62 190 66 0 142 3 rplK Large ribosomal subunit protein uL11 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q035U8 3.19e-62 190 67 1 142 3 rplK Large ribosomal subunit protein uL11 Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
B3WA09 3.19e-62 190 67 1 142 3 rplK Large ribosomal subunit protein uL11 Lacticaseibacillus casei (strain BL23)
Q81J53 3.19e-62 190 68 1 141 3 rplK1 Large ribosomal subunit protein uL11A Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
O87733 3.84e-62 190 67 1 140 3 rplK Large ribosomal subunit protein uL11 Streptomyces lavendulae
A5V9F5 5e-62 189 64 1 143 3 rplK Large ribosomal subunit protein uL11 Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
Q5NPL1 5.4e-62 189 66 1 143 3 rplK Large ribosomal subunit protein uL11 Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q2LQ91 5.4e-62 189 64 1 142 3 rplK Large ribosomal subunit protein uL11 Syntrophus aciditrophicus (strain SB)
Q49V47 5.65e-62 189 68 1 141 3 rplK Large ribosomal subunit protein uL11 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
P60104 6.36e-62 189 63 0 141 3 rplK Large ribosomal subunit protein uL11 Gamma-proteobacterium EBAC31A08
Q98N70 6.95e-62 189 64 0 142 3 rplK Large ribosomal subunit protein uL11 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
B1KT95 7.42e-62 189 68 1 141 3 rplK Large ribosomal subunit protein uL11 Clostridium botulinum (strain Loch Maree / Type A3)
A7GJ86 7.42e-62 189 68 1 141 3 rplK Large ribosomal subunit protein uL11 Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
B1IGG6 7.42e-62 189 68 1 141 3 rplK Large ribosomal subunit protein uL11 Clostridium botulinum (strain Okra / Type B1)
C1FMW3 7.42e-62 189 68 1 141 3 rplK Large ribosomal subunit protein uL11 Clostridium botulinum (strain Kyoto / Type A2)
A5I7L8 7.42e-62 189 68 1 141 3 rplK Large ribosomal subunit protein uL11 Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
C3KVR3 7.42e-62 189 68 1 141 3 rplK Large ribosomal subunit protein uL11 Clostridium botulinum (strain 657 / Type Ba4)
A7FZ81 7.42e-62 189 68 1 141 3 rplK Large ribosomal subunit protein uL11 Clostridium botulinum (strain ATCC 19397 / Type A)
Q830Q5 8.75e-62 189 67 1 141 3 rplK Large ribosomal subunit protein uL11 Enterococcus faecalis (strain ATCC 700802 / V583)
Q1QN48 8.84e-62 189 65 0 140 3 rplK Large ribosomal subunit protein uL11 Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
B8I5B5 1.07e-61 189 67 1 140 3 rplK Large ribosomal subunit protein uL11 Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
B8D0B2 1.11e-61 189 68 1 141 3 rplK Large ribosomal subunit protein uL11 Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562)
B3QYL0 1.2e-61 189 64 1 142 3 rplK Large ribosomal subunit protein uL11 Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
Q3A9Q2 1.2e-61 189 67 1 140 3 rplK Large ribosomal subunit protein uL11 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
A4SGL0 1.39e-61 188 67 1 141 3 rplK Large ribosomal subunit protein uL11 Chlorobium phaeovibrioides (strain DSM 265 / 1930)
B0K5G4 1.39e-61 188 68 1 138 3 rplK Large ribosomal subunit protein uL11 Thermoanaerobacter sp. (strain X514)
B0KCI8 1.39e-61 188 68 1 138 3 rplK Large ribosomal subunit protein uL11 Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
Q0BYA0 1.43e-61 189 65 1 146 3 rplK Large ribosomal subunit protein uL11 Hyphomonas neptunium (strain ATCC 15444)
B0TC43 1.53e-61 188 68 1 138 3 rplK Large ribosomal subunit protein uL11 Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
A0AF47 2.12e-61 188 67 1 141 3 rplK Large ribosomal subunit protein uL11 Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
P66054 2.12e-61 188 67 1 141 1 rplK Large ribosomal subunit protein uL11 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
B8DF07 2.12e-61 188 67 1 141 3 rplK Large ribosomal subunit protein uL11 Listeria monocytogenes serotype 4a (strain HCC23)
Q724G4 2.12e-61 188 67 1 141 3 rplK Large ribosomal subunit protein uL11 Listeria monocytogenes serotype 4b (strain F2365)
C1KYI0 2.12e-61 188 67 1 141 3 rplK Large ribosomal subunit protein uL11 Listeria monocytogenes serotype 4b (strain CLIP80459)
P66055 2.12e-61 188 67 1 141 3 rplK Large ribosomal subunit protein uL11 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q65PC0 2.29e-61 188 70 1 141 3 rplK Large ribosomal subunit protein uL11 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q2GA45 2.45e-61 188 63 1 143 3 rplK Large ribosomal subunit protein uL11 Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
Q890N1 2.45e-61 188 68 1 141 3 rplK Large ribosomal subunit protein uL11 Clostridium tetani (strain Massachusetts / E88)
B8HVL5 2.59e-61 187 65 1 140 3 rplK Large ribosomal subunit protein uL11 Cyanothece sp. (strain PCC 7425 / ATCC 29141)
Q2RFN5 2.65e-61 187 67 1 141 3 rplK Large ribosomal subunit protein uL11 Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q82DQ9 3.25e-61 187 67 1 140 3 rplK Large ribosomal subunit protein uL11 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q3SSY4 3.26e-61 187 65 0 140 3 rplK Large ribosomal subunit protein uL11 Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
C3MAW7 3.33e-61 187 63 0 142 3 rplK Large ribosomal subunit protein uL11 Sinorhizobium fredii (strain NBRC 101917 / NGR234)
B8DLM3 3.48e-61 187 66 1 141 3 rplK Large ribosomal subunit protein uL11 Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
B0TX06 3.59e-61 187 65 0 140 3 rplK Large ribosomal subunit protein uL11 Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
A3DIZ0 4.68e-61 187 65 1 141 3 rplK Large ribosomal subunit protein uL11 Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
B2A4C6 4.99e-61 187 65 1 142 3 rplK Large ribosomal subunit protein uL11 Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
C0QQL2 5.04e-61 187 65 0 142 3 rplK Large ribosomal subunit protein uL11 Persephonella marina (strain DSM 14350 / EX-H1)
A8MLC8 5.1e-61 187 66 1 141 3 rplK Large ribosomal subunit protein uL11 Alkaliphilus oremlandii (strain OhILAs)
C0Q9Y3 5.11e-61 187 67 1 140 3 rplK Large ribosomal subunit protein uL11 Desulforapulum autotrophicum (strain ATCC 43914 / DSM 3382 / VKM B-1955 / HRM2)
P36258 6.55e-61 187 65 1 140 3 rplK Large ribosomal subunit protein uL11 Streptomyces griseus
B1W447 6.55e-61 187 65 1 140 3 rplK Large ribosomal subunit protein uL11 Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
O87085 7.23e-61 187 66 1 140 3 rplK Large ribosomal subunit protein uL11 Streptomyces antibioticus
A7Z0M4 8.26e-61 186 69 1 141 3 rplK Large ribosomal subunit protein uL11 Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q06796 8.26e-61 186 69 1 141 1 rplK Large ribosomal subunit protein uL11 Bacillus subtilis (strain 168)
Q1MPU0 8.45e-61 186 65 1 141 3 rplK Large ribosomal subunit protein uL11 Lawsonia intracellularis (strain PHE/MN1-00)
Q97EG5 8.83e-61 186 68 1 140 3 rplK Large ribosomal subunit protein uL11 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q03ST9 9.32e-61 186 66 1 142 3 rplK Large ribosomal subunit protein uL11 Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q31QK3 9.43e-61 186 66 1 140 3 rplK Large ribosomal subunit protein uL11 Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
A7HWQ0 1.16e-60 186 63 0 140 3 rplK Large ribosomal subunit protein uL11 Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
P27310 1.34e-60 186 65 1 140 3 rplK Large ribosomal subunit protein uL11 Streptomyces virginiae
B2TIG4 1.46e-60 186 65 1 141 3 rplK Large ribosomal subunit protein uL11 Clostridium botulinum (strain Eklund 17B / Type B)
B2UY99 1.46e-60 186 65 1 141 3 rplK Large ribosomal subunit protein uL11 Clostridium botulinum (strain Alaska E43 / Type E3)
A3CPA6 2.03e-60 186 65 1 140 3 rplK Large ribosomal subunit protein uL11 Streptococcus sanguinis (strain SK36)
A1SEI6 2.07e-60 186 65 1 139 3 rplK Large ribosomal subunit protein uL11 Nocardioides sp. (strain ATCC BAA-499 / JS614)
C1CQB5 2.17e-60 185 66 1 140 3 rplK Large ribosomal subunit protein uL11 Streptococcus pneumoniae (strain Taiwan19F-14)
C1CJA5 2.17e-60 185 66 1 140 3 rplK Large ribosomal subunit protein uL11 Streptococcus pneumoniae (strain P1031)
C1CD02 2.17e-60 185 66 1 140 3 rplK Large ribosomal subunit protein uL11 Streptococcus pneumoniae (strain JJA)
Q8CWS9 2.17e-60 185 66 1 140 3 rplK Large ribosomal subunit protein uL11 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
B2IMU7 2.17e-60 185 66 1 140 3 rplK Large ribosomal subunit protein uL11 Streptococcus pneumoniae (strain CGSP14)
Q97RZ6 2.17e-60 185 66 1 140 3 rplK Large ribosomal subunit protein uL11 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
B8ZML8 2.17e-60 185 66 1 140 3 rplK Large ribosomal subunit protein uL11 Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
C1C5Z8 2.17e-60 185 66 1 140 3 rplK Large ribosomal subunit protein uL11 Streptococcus pneumoniae (strain 70585)
B5E2M5 2.17e-60 185 66 1 140 3 rplK Large ribosomal subunit protein uL11 Streptococcus pneumoniae serotype 19F (strain G54)
Q04LP7 2.17e-60 185 66 1 140 3 rplK Large ribosomal subunit protein uL11 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
B1HNL6 2.19e-60 185 66 1 141 3 rplK Large ribosomal subunit protein uL11 Lysinibacillus sphaericus (strain C3-41)
A4W2B7 2.47e-60 185 67 1 140 3 rplK Large ribosomal subunit protein uL11 Streptococcus suis (strain 98HAH33)
Q1WST2 2.47e-60 185 66 1 141 3 rplK Large ribosomal subunit protein uL11 Ligilactobacillus salivarius (strain UCC118)
A8ZUU5 2.5e-60 185 65 1 138 3 rplK Large ribosomal subunit protein uL11 Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)
Q5N3N9 2.7e-60 185 66 1 140 3 rplK Large ribosomal subunit protein uL11 Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
B2V7M4 2.75e-60 185 63 0 142 3 rplK Large ribosomal subunit protein uL11 Sulfurihydrogenibium sp. (strain YO3AOP1)
A6LPQ0 2.76e-60 185 66 1 141 3 rplK Large ribosomal subunit protein uL11 Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
A1VAK0 2.95e-60 185 68 1 141 3 rplK Large ribosomal subunit protein uL11 Nitratidesulfovibrio vulgaris (strain DP4)
P62433 2.95e-60 185 68 1 141 3 rplK Large ribosomal subunit protein uL11 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
B1IAH3 3.18e-60 185 65 1 140 3 rplK Large ribosomal subunit protein uL11 Streptococcus pneumoniae (strain Hungary19A-6)
A0QS45 3.66e-60 185 66 1 139 1 rplK Large ribosomal subunit protein uL11 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q8DM28 3.92e-60 185 63 1 140 3 rplK Large ribosomal subunit protein uL11 Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q8R7U2 4.32e-60 184 66 1 138 3 rplK Large ribosomal subunit protein uL11 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
P56210 4.35e-60 184 69 1 133 1 rplK Large ribosomal subunit protein uL11 (Fragment) Geobacillus stearothermophilus
Q0SQD2 4.77e-60 184 67 1 140 3 rplK Large ribosomal subunit protein uL11 Clostridium perfringens (strain SM101 / Type A)
Q8XHR4 4.77e-60 184 67 1 140 3 rplK Large ribosomal subunit protein uL11 Clostridium perfringens (strain 13 / Type A)
Q0TMN4 4.77e-60 184 67 1 140 3 rplK Large ribosomal subunit protein uL11 Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
C0MHG3 4.93e-60 184 66 1 140 3 rplK Large ribosomal subunit protein uL11 Streptococcus equi subsp. zooepidemicus (strain H70)
B4U476 4.93e-60 184 66 1 140 3 rplK Large ribosomal subunit protein uL11 Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
C0MBU0 4.93e-60 184 66 1 140 3 rplK Large ribosomal subunit protein uL11 Streptococcus equi subsp. equi (strain 4047)
A7I3U3 4.93e-60 184 68 1 141 3 rplK Large ribosomal subunit protein uL11 Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
Q1D7U7 5.01e-60 185 66 2 147 3 rplK Large ribosomal subunit protein uL11 Myxococcus xanthus (strain DK1622)
B8E0K3 5.09e-60 184 65 2 143 3 rplK Large ribosomal subunit protein uL11 Dictyoglomus turgidum (strain DSM 6724 / Z-1310)
B5YEY0 5.09e-60 184 65 2 143 3 rplK Large ribosomal subunit protein uL11 Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12)
Q6AP82 5.09e-60 184 65 1 140 3 rplK Large ribosomal subunit protein uL11 Desulfotalea psychrophila (strain LSv54 / DSM 12343)
B8EMR7 5.55e-60 184 63 0 142 3 rplK Large ribosomal subunit protein uL11 Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
A6U847 5.93e-60 184 61 0 142 3 rplK Large ribosomal subunit protein uL11 Sinorhizobium medicae (strain WSM419)
C4ZB90 6e-60 184 67 1 140 3 rplK Large ribosomal subunit protein uL11 Agathobacter rectalis (strain ATCC 33656 / DSM 3377 / JCM 17463 / KCTC 5835 / VPI 0990)
Q1IHH0 7.3e-60 184 66 1 139 3 rplK Large ribosomal subunit protein uL11 Koribacter versatilis (strain Ellin345)
Q8DYG1 7.98e-60 184 66 1 140 3 rplK Large ribosomal subunit protein uL11 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q3K003 7.98e-60 184 66 1 140 3 rplK Large ribosomal subunit protein uL11 Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
B8J1A4 8.43e-60 184 65 1 141 3 rplK Large ribosomal subunit protein uL11 Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)
A8AY75 1.02e-59 184 65 1 140 3 rplK Large ribosomal subunit protein uL11 Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
Q92QI1 1.06e-59 184 61 0 142 3 rplK Large ribosomal subunit protein uL11 Rhizobium meliloti (strain 1021)
B9DRE8 1.11e-59 184 65 1 140 3 rplK Large ribosomal subunit protein uL11 Streptococcus uberis (strain ATCC BAA-854 / 0140J)
A5D5K4 1.16e-59 184 65 2 143 3 rplK Large ribosomal subunit protein uL11 Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
Q250P8 1.38e-59 183 63 2 143 3 rplK Large ribosomal subunit protein uL11 Desulfitobacterium hafniense (strain Y51)
B8G1V0 1.38e-59 183 63 2 143 3 rplK Large ribosomal subunit protein uL11 Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
Q8E424 1.51e-59 183 65 1 140 3 rplK Large ribosomal subunit protein uL11 Streptococcus agalactiae serotype III (strain NEM316)
Q30X10 1.52e-59 183 65 1 141 3 rplK Large ribosomal subunit protein uL11 Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
B3EL57 1.96e-59 183 70 1 142 3 rplK Large ribosomal subunit protein uL11 Chlorobium phaeobacteroides (strain BS1)
P60102 2.02e-59 183 65 1 140 3 rplK Large ribosomal subunit protein uL11 Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
B1I1L2 2.11e-59 183 64 2 143 3 rplK Large ribosomal subunit protein uL11 Desulforudis audaxviator (strain MP104C)
Q03IP3 2.16e-59 183 65 1 140 3 rplK Large ribosomal subunit protein uL11 Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q5M2J9 2.16e-59 183 65 1 140 3 rplK Large ribosomal subunit protein uL11 Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5LXZ5 2.16e-59 183 65 1 140 3 rplK Large ribosomal subunit protein uL11 Streptococcus thermophilus (strain CNRZ 1066)
A9ISE8 2.87e-59 182 63 0 142 3 rplK Large ribosomal subunit protein uL11 Bartonella tribocorum (strain CIP 105476 / IBS 506)
P0A465 3e-59 182 65 1 140 3 rplK Large ribosomal subunit protein uL11 Streptomyces violaceoruber
P0A464 3e-59 182 65 1 140 3 rplK Large ribosomal subunit protein uL11 Streptomyces lividans
P0A463 3e-59 182 65 1 140 3 rplK Large ribosomal subunit protein uL11 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
A4J0Z9 3.13e-59 182 66 2 143 3 rplK Large ribosomal subunit protein uL11 Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
B5XK61 3.39e-59 182 65 1 140 3 rplK Large ribosomal subunit protein uL11 Streptococcus pyogenes serotype M49 (strain NZ131)
P0DE01 3.39e-59 182 65 1 140 3 rplK Large ribosomal subunit protein uL11 Streptococcus pyogenes serotype M3 (strain SSI-1)
Q48UX9 3.39e-59 182 65 1 140 3 rplK Large ribosomal subunit protein uL11 Streptococcus pyogenes serotype M28 (strain MGAS6180)
A2RG33 3.39e-59 182 65 1 140 3 rplK Large ribosomal subunit protein uL11 Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J835 3.39e-59 182 65 1 140 3 rplK Large ribosomal subunit protein uL11 Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JI80 3.39e-59 182 65 1 140 3 rplK Large ribosomal subunit protein uL11 Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1JN34 3.39e-59 182 65 1 140 3 rplK Large ribosomal subunit protein uL11 Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JD61 3.39e-59 182 65 1 140 3 rplK Large ribosomal subunit protein uL11 Streptococcus pyogenes serotype M12 (strain MGAS2096)
P66059 3.39e-59 182 65 1 140 3 rplK Large ribosomal subunit protein uL11 Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5XDH7 3.39e-59 182 65 1 140 3 rplK Large ribosomal subunit protein uL11 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DE00 3.39e-59 182 65 1 140 3 rplK Large ribosomal subunit protein uL11 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P66058 3.39e-59 182 65 1 140 3 rplK Large ribosomal subunit protein uL11 Streptococcus pyogenes serotype M1
B9JVM4 3.42e-59 182 65 1 143 3 rplK Large ribosomal subunit protein uL11 Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
A6W5S6 4.12e-59 182 65 1 138 3 rplK Large ribosomal subunit protein uL11 Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216)
Q8DSX9 4.41e-59 182 65 1 140 3 rplK Large ribosomal subunit protein uL11 Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q1BDJ6 4.55e-59 182 65 1 139 3 rplK Large ribosomal subunit protein uL11 Mycobacterium sp. (strain MCS)
A1UBE6 4.55e-59 182 65 1 139 3 rplK Large ribosomal subunit protein uL11 Mycobacterium sp. (strain KMS)
B0CAC9 4.55e-59 182 64 1 140 3 rplK Large ribosomal subunit protein uL11 Acaryochloris marina (strain MBIC 11017)
A5FZX5 4.8e-59 182 63 2 144 3 rplK Large ribosomal subunit protein uL11 Acidiphilium cryptum (strain JF-5)
A7IKP6 5.33e-59 182 63 2 149 3 rplK Large ribosomal subunit protein uL11 Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
A9GRA1 5.96e-59 182 63 2 146 3 rplK Large ribosomal subunit protein uL11 Sorangium cellulosum (strain So ce56)
B4UDT6 6.15e-59 182 63 2 147 3 rplK Large ribosomal subunit protein uL11 Anaeromyxobacter sp. (strain K)
Q2II82 6.15e-59 182 63 2 147 3 rplK Large ribosomal subunit protein uL11 Anaeromyxobacter dehalogenans (strain 2CP-C)
B8JB74 6.15e-59 182 63 2 147 3 rplK Large ribosomal subunit protein uL11 Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
B2GII3 6.38e-59 182 66 1 138 3 rplK Large ribosomal subunit protein uL11 Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201)
B8H0P4 6.97e-59 182 61 1 142 3 rplK Large ribosomal subunit protein uL11 Caulobacter vibrioides (strain NA1000 / CB15N)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_17555
Feature type CDS
Gene rplK
Product 50S ribosomal protein L11
Location 2106 - 2534 (strand: 1)
Length 429 (nucleotides) / 142 (amino acids)

Contig

Accession contig_29
Length 39360 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2285
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00298 Ribosomal protein L11, RNA binding domain
PF03946 Ribosomal protein L11, N-terminal domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0080 Translation, ribosomal structure and biogenesis (J) J Ribosomal protein L11

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02867 large subunit ribosomal protein L11 Ribosome -

Protein Sequence

MAKKVQAYIKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAKTDSMEKGLPIPVVITVYADRSFTFITKTPPAAVLLKKAAGLKSGSGKPNKEKVGKITSAQVREIAETKAADMTGADVEAMMRSIEGTARSMGLVVEG

Flanking regions ( +/- flanking 50bp)

TAGGGGAGCCGGGATAACCGGCGCTATTACCCACATTGAGGATTTTTTAAATGGCTAAGAAAGTACAAGCCTATATCAAACTGCAGGTTGCAGCTGGTATGGCAAACCCAAGTCCACCGGTTGGTCCTGCACTGGGTCAGCAGGGTGTGAACATCATGGAATTCTGTAAAGCGTTTAACGCCAAAACAGACAGCATGGAAAAAGGTTTACCAATCCCGGTTGTTATCACCGTTTATGCTGACCGTTCTTTCACTTTCATCACTAAAACTCCGCCAGCGGCAGTTTTACTGAAGAAAGCTGCAGGTCTGAAATCTGGTTCCGGCAAACCGAACAAAGAGAAAGTAGGTAAAATTACTTCTGCTCAGGTTCGTGAGATTGCTGAGACTAAAGCAGCGGATATGACTGGTGCCGATGTAGAAGCTATGATGCGTTCTATCGAAGGTACTGCTCGTTCCATGGGCCTGGTAGTGGAGGGTTAATCGATGGCTAAACTGACCAAGCGCATGCGCAATATCCGTGAAAAAGTTGA