Homologs in group_3459

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_16025 EHELCC_16025 100.0 Morganella morganii S2 - Helix-turn-helix transcriptional regulator
NLDBIP_16340 NLDBIP_16340 100.0 Morganella morganii S4 - Helix-turn-helix transcriptional regulator
LHKJJB_16460 LHKJJB_16460 100.0 Morganella morganii S3 - Helix-turn-helix transcriptional regulator
HKOGLL_16230 HKOGLL_16230 100.0 Morganella morganii S5 - Helix-turn-helix transcriptional regulator

Distribution of the homologs in the orthogroup group_3459

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3459

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_15670
Feature type CDS
Gene -
Product Helix-turn-helix transcriptional regulator
Location 69407 - 69622 (strand: -1)
Length 216 (nucleotides) / 71 (amino acids)
In genomic island -

Contig

Accession contig_21
Length 81362 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3459
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Domains

PF13443 Cro/C1-type HTH DNA-binding domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3655 Transcription (K) K DNA-binding transcriptional regulator, XRE family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07727 putative transcriptional regulator - -

Protein Sequence

MIRCHLARLMGEQKMRISDVMRETGLSRTTVTLLYKETALKVDLEALDKLCDLFKCSLSDILEKVPSDSQR

Flanking regions ( +/- flanking 50bp)

GCAACAGTGATAACACCCAGAGTTTATAGTTAAAACACCGTGGAGAAAGCATGATCCGCTGCCACCTTGCCCGCTTAATGGGTGAACAAAAAATGCGCATTAGCGACGTAATGCGAGAAACGGGCCTTAGCCGTACCACAGTGACGCTACTTTACAAAGAAACCGCGCTCAAGGTGGATTTAGAAGCGCTCGATAAGCTGTGTGATTTATTTAAGTGTTCATTGAGCGACATATTGGAAAAAGTGCCAAGCGATAGCCAACGCTAAAAAGCATCAAGGAGTGATGACATGTCGTCAGAAGCAGATACCAGAGCAAA