Homologs in group_2067

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_15830 EHELCC_15830 100.0 Morganella morganii S2 atpE F0F1 ATP synthase subunit C
NLDBIP_16540 NLDBIP_16540 100.0 Morganella morganii S4 atpE F0F1 ATP synthase subunit C
LHKJJB_16265 LHKJJB_16265 100.0 Morganella morganii S3 atpE F0F1 ATP synthase subunit C
HKOGLL_16035 HKOGLL_16035 100.0 Morganella morganii S5 atpE F0F1 ATP synthase subunit C
F4V73_RS17675 F4V73_RS17675 100.0 Morganella psychrotolerans atpE F0F1 ATP synthase subunit C
PMI_RS15150 PMI_RS15150 97.5 Proteus mirabilis HI4320 atpE F0F1 ATP synthase subunit C

Distribution of the homologs in the orthogroup group_2067

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2067

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B1JR36 7.53e-48 149 100 0 79 3 atpE ATP synthase subunit c Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q663Q3 7.53e-48 149 100 0 79 3 atpE ATP synthase subunit c Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TSI8 7.53e-48 149 100 0 79 3 atpE ATP synthase subunit c Yersinia pestis (strain Pestoides F)
Q1CCH0 7.53e-48 149 100 0 79 3 atpE ATP synthase subunit c Yersinia pestis bv. Antiqua (strain Nepal516)
A9R5U4 7.53e-48 149 100 0 79 3 atpE ATP synthase subunit c Yersinia pestis bv. Antiqua (strain Angola)
P68706 7.53e-48 149 100 0 79 3 atpE ATP synthase subunit c Yersinia pestis
B2K842 7.53e-48 149 100 0 79 3 atpE ATP synthase subunit c Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C090 7.53e-48 149 100 0 79 3 atpE ATP synthase subunit c Yersinia pestis bv. Antiqua (strain Antiqua)
A7FPE5 7.53e-48 149 100 0 79 3 atpE ATP synthase subunit c Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q2NQ91 7.53e-48 149 100 0 79 3 atpE ATP synthase subunit c Sodalis glossinidius (strain morsitans)
Q3YVP1 7.53e-48 149 100 0 79 3 atpE ATP synthase subunit c Shigella sonnei (strain Ss046)
P68705 7.53e-48 149 100 0 79 3 atpE ATP synthase subunit c Shigella flexneri
Q0SYT9 7.53e-48 149 100 0 79 3 atpE ATP synthase subunit c Shigella flexneri serotype 5b (strain 8401)
Q329S6 7.53e-48 149 100 0 79 3 atpE ATP synthase subunit c Shigella dysenteriae serotype 1 (strain Sd197)
Q31UN7 7.53e-48 149 100 0 79 3 atpE ATP synthase subunit c Shigella boydii serotype 4 (strain Sb227)
B2TUN8 7.53e-48 149 100 0 79 3 atpE ATP synthase subunit c Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
P68704 7.53e-48 149 100 0 79 3 atpE ATP synthase subunit c Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P68703 7.53e-48 149 100 0 79 3 atpE ATP synthase subunit c Salmonella typhi
B4TN36 7.53e-48 149 100 0 79 3 atpE ATP synthase subunit c Salmonella schwarzengrund (strain CVM19633)
B5BIP1 7.53e-48 149 100 0 79 3 atpE ATP synthase subunit c Salmonella paratyphi A (strain AKU_12601)
C0Q2N7 7.53e-48 149 100 0 79 3 atpE ATP synthase subunit c Salmonella paratyphi C (strain RKS4594)
A9MXB1 7.53e-48 149 100 0 79 3 atpE ATP synthase subunit c Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PKW7 7.53e-48 149 100 0 79 3 atpE ATP synthase subunit c Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SYD6 7.53e-48 149 100 0 79 3 atpE ATP synthase subunit c Salmonella newport (strain SL254)
B4TAX7 7.53e-48 149 100 0 79 3 atpE ATP synthase subunit c Salmonella heidelberg (strain SL476)
B5RFV8 7.53e-48 149 100 0 79 3 atpE ATP synthase subunit c Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QVD7 7.53e-48 149 100 0 79 3 atpE ATP synthase subunit c Salmonella enteritidis PT4 (strain P125109)
B5FN38 7.53e-48 149 100 0 79 3 atpE ATP synthase subunit c Salmonella dublin (strain CT_02021853)
Q57HX4 7.53e-48 149 100 0 79 3 atpE ATP synthase subunit c Salmonella choleraesuis (strain SC-B67)
A9MJR4 7.53e-48 149 100 0 79 3 atpE ATP synthase subunit c Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5EZ01 7.53e-48 149 100 0 79 3 atpE ATP synthase subunit c Salmonella agona (strain SL483)
P68702 7.53e-48 149 100 0 79 3 atpE ATP synthase subunit c Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A6TG41 7.53e-48 149 100 0 79 3 atpE ATP synthase subunit c Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XZL9 7.53e-48 149 100 0 79 3 atpE ATP synthase subunit c Klebsiella pneumoniae (strain 342)
B7LK82 7.53e-48 149 100 0 79 3 atpE ATP synthase subunit c Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
A4WGF0 7.53e-48 149 100 0 79 3 atpE ATP synthase subunit c Enterobacter sp. (strain 638)
Q1R4J5 7.53e-48 149 100 0 79 3 atpE ATP synthase subunit c Escherichia coli (strain UTI89 / UPEC)
B1LL64 7.53e-48 149 100 0 79 3 atpE ATP synthase subunit c Escherichia coli (strain SMS-3-5 / SECEC)
B6I3X4 7.53e-48 149 100 0 79 3 atpE ATP synthase subunit c Escherichia coli (strain SE11)
B7NF53 7.53e-48 149 100 0 79 3 atpE ATP synthase subunit c Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P68699 7.53e-48 149 100 0 79 1 atpE ATP synthase subunit c Escherichia coli (strain K12)
B1IX01 7.53e-48 149 100 0 79 3 atpE ATP synthase subunit c Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P68700 7.53e-48 149 100 0 79 3 atpE ATP synthase subunit c Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TAX2 7.53e-48 149 100 0 79 3 atpE ATP synthase subunit c Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A8A6K0 7.53e-48 149 100 0 79 3 atpE ATP synthase subunit c Escherichia coli O9:H4 (strain HS)
B1X9W5 7.53e-48 149 100 0 79 3 atpE ATP synthase subunit c Escherichia coli (strain K12 / DH10B)
C4ZZ15 7.53e-48 149 100 0 79 3 atpE ATP synthase subunit c Escherichia coli (strain K12 / MC4100 / BW2952)
B7M593 7.53e-48 149 100 0 79 3 atpE ATP synthase subunit c Escherichia coli O8 (strain IAI1)
B7N2H6 7.53e-48 149 100 0 79 3 atpE ATP synthase subunit c Escherichia coli O81 (strain ED1a)
B7NR39 7.53e-48 149 100 0 79 3 atpE ATP synthase subunit c Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YXE1 7.53e-48 149 100 0 79 3 atpE ATP synthase subunit c Escherichia coli O157:H7 (strain EC4115 / EHEC)
P68701 7.53e-48 149 100 0 79 3 atpE ATP synthase subunit c Escherichia coli O157:H7
B7L883 7.53e-48 149 100 0 79 3 atpE ATP synthase subunit c Escherichia coli (strain 55989 / EAEC)
B7MGF7 7.53e-48 149 100 0 79 3 atpE ATP synthase subunit c Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UMK2 7.53e-48 149 100 0 79 3 atpE ATP synthase subunit c Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZTU9 7.53e-48 149 100 0 79 3 atpE ATP synthase subunit c Escherichia coli O139:H28 (strain E24377A / ETEC)
A7MMV9 7.53e-48 149 100 0 79 3 atpE ATP synthase subunit c Cronobacter sakazakii (strain ATCC BAA-894)
A8ACP3 7.53e-48 149 100 0 79 3 atpE ATP synthase subunit c Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B2VCA9 9.35e-48 149 98 0 79 3 atpE ATP synthase subunit c Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A1JTD2 1.16e-47 148 98 0 79 3 atpE ATP synthase subunit c Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A8G7M3 3e-47 147 98 0 79 3 atpE ATP synthase subunit c Serratia proteamaculans (strain 568)
C5BF35 3e-47 147 98 0 79 3 atpE ATP synthase subunit c Edwardsiella ictaluri (strain 93-146)
B4F0E2 6.41e-47 146 97 0 79 3 atpE ATP synthase subunit c Proteus mirabilis (strain HI4320)
C6DJG7 5.83e-46 144 96 0 79 3 atpE ATP synthase subunit c Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6CYJ0 5.83e-46 144 96 0 79 3 atpE ATP synthase subunit c Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q7VQW1 2.24e-43 137 87 0 78 3 atpE ATP synthase subunit c Blochmanniella floridana
B8D6S2 1.3e-42 135 83 0 79 3 atpE ATP synthase subunit c Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57119 1.3e-42 135 83 0 79 3 atpE ATP synthase subunit c Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D8G8 1.3e-42 135 83 0 79 3 atpE ATP synthase subunit c Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
Q8D3J8 7.73e-40 129 79 0 79 3 atpE ATP synthase subunit c Wigglesworthia glossinidia brevipalpis
Q89B44 4.38e-39 127 80 0 78 3 atpE ATP synthase subunit c Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
A0KQY3 4.81e-39 127 94 0 79 3 atpE ATP synthase subunit c Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A4STP8 8.28e-37 121 73 0 79 3 atpE ATP synthase subunit c Aeromonas salmonicida (strain A449)
Q3SF61 3.43e-35 117 74 0 77 3 atpE ATP synthase subunit c Thiobacillus denitrificans (strain ATCC 25259)
Q494C8 4.97e-31 106 88 0 77 3 atpE ATP synthase subunit c Blochmanniella pennsylvanica (strain BPEN)
O51877 9.6e-30 103 82 0 79 3 atpE ATP synthase subunit c Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q1LTU9 1.3e-29 103 86 0 79 3 atpE ATP synthase subunit c Baumannia cicadellinicola subsp. Homalodisca coagulata
B3PIT2 2.19e-28 100 74 0 63 3 atpE ATP synthase subunit c Cellvibrio japonicus (strain Ueda107)
A8HAG8 1.39e-21 83 57 1 77 3 atpE ATP synthase subunit c Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B0TQF9 1.39e-21 83 57 1 77 3 atpE ATP synthase subunit c Shewanella halifaxensis (strain HAW-EB4)
A1RQB5 2.14e-21 82 57 1 77 3 atpE ATP synthase subunit c Shewanella sp. (strain W3-18-1)
A4YCI3 2.14e-21 82 57 1 77 3 atpE ATP synthase subunit c Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
B1JFU6 2.95e-21 82 54 1 77 3 atpE ATP synthase subunit c Pseudomonas putida (strain W619)
Q88BW9 2.95e-21 82 54 1 77 3 atpE ATP synthase subunit c Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KRB3 2.95e-21 82 54 1 77 3 atpE ATP synthase subunit c Pseudomonas putida (strain GB-1)
Q3K436 2.95e-21 82 54 1 77 3 atpE ATP synthase subunit c Pseudomonas fluorescens (strain Pf0-1)
A5WBA8 2.95e-21 82 54 1 77 3 atpE ATP synthase subunit c Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q1I2I2 2.95e-21 82 54 1 77 3 atpE ATP synthase subunit c Pseudomonas entomophila (strain L48)
Q9HT15 2.95e-21 82 54 1 77 3 atpE ATP synthase subunit c Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02DE9 2.95e-21 82 54 1 77 3 atpE ATP synthase subunit c Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V796 2.95e-21 82 54 1 77 3 atpE ATP synthase subunit c Pseudomonas aeruginosa (strain LESB58)
A6VF37 2.95e-21 82 54 1 77 3 atpE ATP synthase subunit c Pseudomonas aeruginosa (strain PA7)
Q4ZL19 3.02e-21 82 54 1 77 3 atpE ATP synthase subunit c Pseudomonas syringae pv. syringae (strain B728a)
Q87TS9 3.02e-21 82 54 1 77 3 atpE ATP synthase subunit c Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
C3K1F1 3.02e-21 82 54 1 77 3 atpE ATP synthase subunit c Pseudomonas fluorescens (strain SBW25)
Q4K3A4 3.02e-21 82 54 1 77 3 atpE ATP synthase subunit c Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q48BG0 3.02e-21 82 54 1 77 3 atpE ATP synthase subunit c Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
B0VBP8 3.09e-21 82 50 0 75 3 atpE ATP synthase subunit c Acinetobacter baumannii (strain AYE)
A3M139 3.09e-21 82 50 0 75 1 atpE ATP synthase subunit c Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B0VNJ9 3.09e-21 82 50 0 75 3 atpE ATP synthase subunit c Acinetobacter baumannii (strain SDF)
B2I0Z7 3.09e-21 82 50 0 75 3 atpE ATP synthase subunit c Acinetobacter baumannii (strain ACICU)
B7I1V9 3.09e-21 82 50 0 75 3 atpE ATP synthase subunit c Acinetobacter baumannii (strain AB0057)
B7H299 3.09e-21 82 50 0 75 3 atpE ATP synthase subunit c Acinetobacter baumannii (strain AB307-0294)
Q6FFK5 3.09e-21 82 50 0 75 3 atpE ATP synthase subunit c Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q12HP6 1.17e-20 80 57 0 66 3 atpE ATP synthase subunit c Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
A1SBU5 1.27e-20 80 56 0 67 3 atpE ATP synthase subunit c Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
B1KQ39 5.49e-20 79 56 0 66 3 atpE ATP synthase subunit c Shewanella woodyi (strain ATCC 51908 / MS32)
A8G1X0 5.49e-20 79 56 0 66 3 atpE ATP synthase subunit c Shewanella sediminis (strain HAW-EB3)
B8CVV0 5.49e-20 79 56 0 66 3 atpE ATP synthase subunit c Shewanella piezotolerans (strain WP3 / JCM 13877)
A3QJR5 5.49e-20 79 56 0 66 3 atpE ATP synthase subunit c Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q0HPF6 5.74e-20 79 56 0 66 3 atpE ATP synthase subunit c Shewanella sp. (strain MR-7)
Q0HD74 5.74e-20 79 56 0 66 3 atpE ATP synthase subunit c Shewanella sp. (strain MR-4)
A0L2T3 5.74e-20 79 56 0 66 3 atpE ATP synthase subunit c Shewanella sp. (strain ANA-3)
Q8E8B5 5.74e-20 79 56 0 66 3 atpE ATP synthase subunit c Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A9KX11 5.74e-20 79 56 0 66 3 atpE ATP synthase subunit c Shewanella baltica (strain OS195)
A6WUJ5 5.74e-20 79 56 0 66 3 atpE ATP synthase subunit c Shewanella baltica (strain OS185)
A3DAR9 5.74e-20 79 56 0 66 3 atpE ATP synthase subunit c Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8EDV5 5.74e-20 79 56 0 66 3 atpE ATP synthase subunit c Shewanella baltica (strain OS223)
Q5QZI1 1.33e-19 77 59 0 67 3 atpE ATP synthase subunit c Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
A6VL62 4.27e-19 76 58 0 65 3 atpE ATP synthase subunit c Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
C3LSJ4 4.53e-19 76 49 1 77 3 atpE ATP synthase subunit c Vibrio cholerae serotype O1 (strain M66-2)
Q9KNH0 4.53e-19 76 49 1 77 3 atpE ATP synthase subunit c Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
B0BRX7 5.09e-19 76 58 0 65 3 atpE ATP synthase subunit c Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3H2P8 5.09e-19 76 58 0 65 3 atpE ATP synthase subunit c Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N2U9 5.09e-19 76 58 0 65 3 atpE ATP synthase subunit c Actinobacillus pleuropneumoniae serotype 5b (strain L20)
B8F769 5.15e-19 76 58 0 65 3 atpE ATP synthase subunit c Glaesserella parasuis serovar 5 (strain SH0165)
P43721 6e-19 76 58 0 65 3 atpE ATP synthase subunit c Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UGZ4 6e-19 76 58 0 65 3 atpE ATP synthase subunit c Haemophilus influenzae (strain PittGG)
Q4QN59 6e-19 76 58 0 65 3 atpE ATP synthase subunit c Haemophilus influenzae (strain 86-028NP)
A5UA06 6.55e-19 76 58 0 65 3 atpE ATP synthase subunit c Haemophilus influenzae (strain PittEE)
B6EHU2 7.26e-19 76 50 1 77 3 atpE ATP synthase subunit c Aliivibrio salmonicida (strain LFI1238)
Q8DDH3 1.21e-18 75 52 0 67 3 atpE ATP synthase subunit c Vibrio vulnificus (strain CMCP6)
P0A308 1.93e-18 75 49 1 77 3 atpE ATP synthase subunit c Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
P0A309 1.93e-18 75 49 1 77 3 atpE ATP synthase subunit c Vibrio alginolyticus
B5FCZ6 1.94e-18 75 49 1 77 3 atpE ATP synthase subunit c Aliivibrio fischeri (strain MJ11)
Q5E1N2 1.94e-18 75 49 1 77 3 atpE ATP synthase subunit c Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q9CKW5 2.11e-18 75 55 0 67 3 atpE ATP synthase subunit c Pasteurella multocida (strain Pm70)
Q3IK45 4.92e-18 73 48 0 74 3 atpE ATP synthase subunit c Pseudoalteromonas translucida (strain TAC 125)
A9BPU2 4.73e-17 71 50 1 77 3 atpE ATP synthase subunit c Delftia acidovorans (strain DSM 14801 / SPH-1)
A1W2T2 4.73e-17 71 50 1 77 3 atpE ATP synthase subunit c Acidovorax sp. (strain JS42)
B9MB98 4.73e-17 71 50 1 77 3 atpE ATP synthase subunit c Acidovorax ebreus (strain TPSY)
A1TJ36 1.98e-16 69 49 1 77 3 atpE ATP synthase subunit c Paracidovorax citrulli (strain AAC00-1)
A1WF53 2.59e-16 69 53 0 67 3 atpE ATP synthase subunit c Verminephrobacter eiseniae (strain EF01-2)
A1K1R7 3.56e-16 69 48 1 77 3 atpE ATP synthase subunit c Azoarcus sp. (strain BH72)
Q5P4E7 3.78e-16 69 48 1 77 3 atpE ATP synthase subunit c Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q7VPP5 7.75e-16 68 61 0 55 3 atpE ATP synthase subunit c Haemophilus ducreyi (strain 35000HP / ATCC 700724)
A2SC65 9.16e-16 68 48 1 77 3 atpE ATP synthase subunit c Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
B0UWH0 1.12e-15 68 50 1 77 3 atpE ATP synthase subunit c Histophilus somni (strain 2336)
Q12GQ5 1.88e-15 67 46 1 77 3 atpE ATP synthase subunit c Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q0I5W8 1.13e-13 62 60 0 51 3 atpE ATP synthase subunit c Histophilus somni (strain 129Pt)
Q3J6M6 2.96e-11 57 39 1 73 3 atpE ATP synthase subunit c Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
P42011 3.22e-11 56 47 0 63 3 atpE ATP synthase subunit c Geobacillus stearothermophilus
A9VSA8 9.4e-11 55 45 0 70 3 atpE ATP synthase subunit c Bacillus mycoides (strain KBAB4)
Q6HAX4 9.4e-11 55 45 0 70 3 atpE ATP synthase subunit c Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q630T8 9.4e-11 55 45 0 70 3 atpE ATP synthase subunit c Bacillus cereus (strain ZK / E33L)
Q814V7 9.4e-11 55 45 0 70 3 atpE ATP synthase subunit c Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B9IRU2 9.4e-11 55 45 0 70 3 atpE ATP synthase subunit c Bacillus cereus (strain Q1)
B7HY70 9.4e-11 55 45 0 70 3 atpE ATP synthase subunit c Bacillus cereus (strain AH187)
B7HFK7 9.4e-11 55 45 0 70 3 atpE ATP synthase subunit c Bacillus cereus (strain B4264)
C1F0N3 9.4e-11 55 45 0 70 3 atpE ATP synthase subunit c Bacillus cereus (strain 03BB102)
B7IQW3 9.4e-11 55 45 0 70 3 atpE ATP synthase subunit c Bacillus cereus (strain G9842)
Q72XE3 9.4e-11 55 45 0 70 3 atpE ATP synthase subunit c Bacillus cereus (strain ATCC 10987 / NRS 248)
B7JGN5 9.4e-11 55 45 0 70 3 atpE ATP synthase subunit c Bacillus cereus (strain AH820)
Q81JZ0 9.4e-11 55 45 0 70 3 atpE ATP synthase subunit c Bacillus anthracis
A0RLA0 9.4e-11 55 45 0 70 3 atpE ATP synthase subunit c Bacillus thuringiensis (strain Al Hakam)
C3LFI4 9.4e-11 55 45 0 70 3 atpE ATP synthase subunit c Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P1F9 9.4e-11 55 45 0 70 3 atpE ATP synthase subunit c Bacillus anthracis (strain A0248)
A7GV61 9.93e-11 55 45 0 70 3 atpE ATP synthase subunit c Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q04G25 1.2e-10 54 46 0 62 3 atpE ATP synthase subunit c Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
B1Y3T2 1.78e-10 54 46 1 77 3 atpE ATP synthase subunit c Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
Q31DL5 2.81e-10 54 38 1 81 3 atpE ATP synthase subunit c Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
P41173 5.26e-10 53 37 0 67 3 atpE ATP synthase subunit c Acidithiobacillus ferridurans
B5ER47 5.26e-10 53 37 0 67 3 atpE ATP synthase subunit c Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7JB89 5.26e-10 53 37 0 67 3 atpE ATP synthase subunit c Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
Q88UT8 8.58e-10 52 47 0 65 3 atpE ATP synthase subunit c Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
P20603 2.75e-09 51 46 0 58 3 atpE ATP synthase subunit c Priestia megaterium (strain ATCC 12872 / QMB1551)
B0RED9 1.36e-08 49 44 1 65 3 atpE ATP synthase subunit c Clavibacter sepedonicus
Q83G86 1.45e-08 49 42 1 64 3 atpE ATP synthase subunit c Tropheryma whipplei (strain Twist)
Q83HY5 1.45e-08 49 42 1 64 3 atpE ATP synthase subunit c Tropheryma whipplei (strain TW08/27)
A5CQ53 1.49e-08 49 44 1 65 3 atpE ATP synthase subunit c Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382)
Q4L7Y9 1.54e-08 49 42 0 66 3 atpE ATP synthase subunit c Staphylococcus haemolyticus (strain JCSC1435)
B9DME9 2.52e-08 48 40 0 66 3 atpE ATP synthase subunit c Staphylococcus carnosus (strain TM300)
Q49Z55 1.05e-07 47 46 0 58 3 atpE ATP synthase subunit c Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q8CNJ2 1.32e-07 47 46 0 58 3 atpE ATP synthase subunit c Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HMB4 1.32e-07 47 46 0 58 3 atpE ATP synthase subunit c Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q7A0C3 1.32e-07 47 46 0 58 3 atpE ATP synthase subunit c Staphylococcus aureus (strain MW2)
A8YY75 1.32e-07 47 46 0 58 3 atpE ATP synthase subunit c Staphylococcus aureus (strain USA300 / TCH1516)
Q6G7K2 1.32e-07 47 46 0 58 3 atpE ATP synthase subunit c Staphylococcus aureus (strain MSSA476)
Q6GEW7 1.32e-07 47 46 0 58 3 atpE ATP synthase subunit c Staphylococcus aureus (strain MRSA252)
Q7A4E6 1.32e-07 47 46 0 58 3 atpE ATP synthase subunit c Staphylococcus aureus (strain N315)
Q99SF0 1.32e-07 47 46 0 58 3 atpE ATP synthase subunit c Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QIV2 1.32e-07 47 46 0 58 3 atpE ATP synthase subunit c Staphylococcus aureus (strain Newman)
Q5HE92 1.32e-07 47 46 0 58 3 atpE ATP synthase subunit c Staphylococcus aureus (strain COL)
Q2YUJ6 1.32e-07 47 46 0 58 3 atpE ATP synthase subunit c Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5IUQ3 1.32e-07 47 46 0 58 3 atpE ATP synthase subunit c Staphylococcus aureus (strain JH9)
Q2G2F6 1.32e-07 47 46 0 58 3 atpE ATP synthase subunit c Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FF19 1.32e-07 47 46 0 58 3 atpE ATP synthase subunit c Staphylococcus aureus (strain USA300)
A6U3J3 1.32e-07 47 46 0 58 3 atpE ATP synthase subunit c Staphylococcus aureus (strain JH1)
A7X4V0 1.32e-07 47 46 0 58 3 atpE ATP synthase subunit c Staphylococcus aureus (strain Mu3 / ATCC 700698)
A1A3D0 8.66e-07 45 48 0 49 3 atpE ATP synthase subunit c Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a)
Q03QY3 1.01e-06 45 55 0 43 3 atpE ATP synthase subunit c Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q03EK9 2e-06 44 54 0 42 3 atpE ATP synthase subunit c Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
Q5KUI8 6.38e-06 42 49 0 63 3 atpE ATP synthase subunit c Geobacillus kaustophilus (strain HTA426)
P00845 6.38e-06 42 49 0 63 1 atpE ATP synthase subunit c Bacillus sp. (strain PS3)
B8DWS7 1.47e-05 42 46 0 49 3 atpE ATP synthase subunit c Bifidobacterium animalis subsp. lactis (strain AD011)
Q03A23 1.49e-05 42 45 0 44 3 atpE ATP synthase subunit c Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
B3WDL3 1.49e-05 42 45 0 44 3 atpE ATP synthase subunit c Lacticaseibacillus casei (strain BL23)
Q38WK0 1.81e-05 41 33 0 53 3 atpE ATP synthase subunit c Latilactobacillus sakei subsp. sakei (strain 23K)
Q74K20 2.27e-05 41 38 0 52 3 atpE ATP synthase subunit c Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
P26682 3.39e-05 40 42 0 52 3 atpE ATP synthase subunit c Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R)
B6YR09 8.13e-05 40 39 0 61 3 atpE ATP synthase subunit c Azobacteroides pseudotrichonymphae genomovar. CFP2
A8YUJ6 8.28e-05 40 40 0 50 3 atpE ATP synthase subunit c Lactobacillus helveticus (strain DPC 4571)
P28530 0.000116 40 35 0 67 3 atpH ATP synthase subunit c, chloroplastic Diacronema lutheri
P41015 0.00013 39 47 0 63 3 atpE ATP synthase subunit c Bacillus caldotenax
B7GTY8 0.000165 39 34 1 67 3 atpE ATP synthase subunit c Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)
Q8G7A8 0.000167 39 34 1 67 3 atpE ATP synthase subunit c Bifidobacterium longum (strain NCC 2705)
B3DTV5 0.000167 39 34 1 67 3 atpE ATP synthase subunit c Bifidobacterium longum (strain DJO10A)
B2XTP2 0.000193 39 33 1 77 3 atpH ATP synthase subunit c, chloroplastic Heterosigma akashiwo (strain CCMP452 / OLISTH)
B2XT86 0.000193 39 33 1 77 3 atpH ATP synthase subunit c, chloroplastic Heterosigma akashiwo (strain NIES-293 / 8280G21-1)
Q8MA07 0.000376 38 32 0 67 3 atpH ATP synthase subunit c, chloroplastic Chaetosphaeridium globosum
B5LMM9 0.000442 38 32 0 67 3 atpH ATP synthase subunit c, chloroplastic Cicer arietinum
B1YEG1 0.000446 38 47 0 38 3 atpE ATP synthase subunit c Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
Q8A9V0 0.000448 38 40 0 52 3 atpE ATP synthase subunit c Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
B2Y1W0 0.000457 38 32 0 67 3 atpH ATP synthase subunit c, chloroplastic Welwitschia mirabilis
A6BM12 0.000457 38 32 0 67 3 atpH ATP synthase subunit c, chloroplastic Gnetum parvifolium
A0T0E7 0.000577 38 33 1 77 3 atpH ATP synthase subunit c, chloroplastic Phaeodactylum tricornutum (strain CCAP 1055/1)
B1VKH8 0.000598 38 32 0 67 3 atpH ATP synthase subunit c, chloroplastic Cryptomeria japonica
Q19VA3 0.000603 38 32 0 67 3 atpH ATP synthase subunit c, chloroplastic Chlorokybus atmophyticus
P41603 0.000645 38 32 1 77 3 atpH ATP synthase subunit c, chloroplastic Pinus thunbergii
Q7GUD2 0.000645 38 32 1 77 3 atpH ATP synthase subunit c, chloroplastic Pinus koraiensis
P08212 0.000718 37 31 0 67 1 atpH ATP synthase subunit c, chloroplastic Pisum sativum
A7Y3A9 0.000718 37 32 1 77 3 atpH ATP synthase subunit c, chloroplastic Ipomoea purpurea
P10603 0.000733 37 32 0 67 3 atpH ATP synthase subunit c, chloroplastic Euglena gracilis
Q32RS6 0.000749 37 32 0 67 3 atpH ATP synthase subunit c, chloroplastic Staurastrum punctulatum
A9QC36 0.000799 37 32 0 67 3 atpH ATP synthase subunit c, chloroplastic Trachelium caeruleum
Q2VEI9 0.000799 37 32 0 67 3 atpH ATP synthase subunit c, chloroplastic Solanum tuberosum
Q06GS3 0.000799 37 32 0 67 3 atpH ATP synthase subunit c, chloroplastic Piper cenocladum
Q6YXK1 0.000799 37 32 0 67 3 atpH ATP synthase subunit c, chloroplastic Physcomitrium patens
Q06FX4 0.000799 37 32 0 67 3 atpH ATP synthase subunit c, chloroplastic Pelargonium hortorum
B0Z5D2 0.000799 37 32 0 67 3 atpH ATP synthase subunit c, chloroplastic Oenothera parviflora
B0Z548 0.000799 37 32 0 67 3 atpH ATP synthase subunit c, chloroplastic Oenothera glazioviana
P62480 0.000799 37 32 0 67 3 atpH ATP synthase subunit c, chloroplastic Oenothera elata subsp. hookeri
B0Z4W4 0.000799 37 32 0 67 3 atpH ATP synthase subunit c, chloroplastic Oenothera biennis
B0Z4N0 0.000799 37 32 0 67 3 atpH ATP synthase subunit c, chloroplastic Oenothera argillicola
P62481 0.000799 37 32 0 67 3 atpH ATP synthase subunit c, chloroplastic Marchantia polymorpha
Q6WQW2 0.000799 37 32 0 67 3 atpH ATP synthase subunit c, chloroplastic Cucumis sativus
A8W3H7 0.001 37 32 0 67 3 atpE ATP synthase subunit C, plastid Cuscuta obtusiflora
A7M8Z1 0.001 37 32 0 67 3 atpE ATP synthase subunit C, plastid Cuscuta gronovii
Q0P3K7 0.001 37 33 1 77 3 atpH ATP synthase subunit c, chloroplastic Ostreococcus tauri
A0ZZ22 0.001 37 31 0 67 3 atpH ATP synthase subunit c, chloroplastic Gossypium barbadense

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_15470
Feature type CDS
Gene atpE
Product F0F1 ATP synthase subunit C
Location 20049 - 20288 (strand: 1)
Length 240 (nucleotides) / 79 (amino acids)

Contig

Accession contig_21
Length 81362 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2067
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00137 ATP synthase subunit C

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0636 Energy production and conversion (C) C FoF1-type ATP synthase, membrane subunit c/Archaeal/vacuolar-type H+-ATPase, subunit K

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02110 F-type H+-transporting ATPase subunit c Oxidative phosphorylation
Photosynthesis
Metabolic pathways		 F-type ATPase, prokaryotes and chloroplasts

Protein Sequence

MENLNMDLLYMAAAVMMGLAAIGAAIGIGILGGKFLEGAARQPDLIPLLRTQFFIVMGLVDAIPMIAVGLGLYVMFAVA

Flanking regions ( +/- flanking 50bp)

AATTTTATTACCAATAACTGTGATTTAACTGAAACAAACTGGAGACTGTCATGGAAAACCTGAATATGGATCTGCTGTACATGGCTGCCGCTGTAATGATGGGCCTGGCGGCTATCGGTGCTGCGATCGGTATCGGCATCCTCGGTGGGAAATTTTTAGAAGGCGCTGCACGCCAGCCGGATTTAATCCCTCTGCTGCGTACTCAGTTCTTCATCGTAATGGGTCTGGTTGACGCCATCCCGATGATTGCTGTGGGTCTGGGCTTGTATGTAATGTTTGCGGTTGCGTAGTGATACGCCCACTCCCGGATATTTACATCAACTCAATTAGATAAAGAGGT