Homologs in group_2064

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_15815 EHELCC_15815 100.0 Morganella morganii S2 rsmG 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG
NLDBIP_16555 NLDBIP_16555 100.0 Morganella morganii S4 rsmG 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG
LHKJJB_16250 LHKJJB_16250 100.0 Morganella morganii S3 rsmG 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG
HKOGLL_16020 HKOGLL_16020 100.0 Morganella morganii S5 rsmG 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG
F4V73_RS17690 F4V73_RS17690 87.5 Morganella psychrotolerans rsmG 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG
PMI_RS15135 PMI_RS15135 70.7 Proteus mirabilis HI4320 rsmG 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG

Distribution of the homologs in the orthogroup group_2064

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2064

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
A8GLL1 4.05e-111 319 75 1 206 3 rsmG Ribosomal RNA small subunit methyltransferase G Serratia proteamaculans (strain 568)
Q7NA87 2.72e-109 314 77 1 204 3 rsmG Ribosomal RNA small subunit methyltransferase G Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B2VCB2 1.93e-108 312 75 2 201 3 rsmG Ribosomal RNA small subunit methyltransferase G Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A1JTD7 2.52e-108 312 75 1 204 3 rsmG Ribosomal RNA small subunit methyltransferase G Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q663Q0 1.09e-106 308 74 1 204 3 rsmG Ribosomal RNA small subunit methyltransferase G Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TSI5 1.09e-106 308 74 1 204 3 rsmG Ribosomal RNA small subunit methyltransferase G Yersinia pestis (strain Pestoides F)
Q1CCG7 1.09e-106 308 74 1 204 3 rsmG Ribosomal RNA small subunit methyltransferase G Yersinia pestis bv. Antiqua (strain Nepal516)
A9R5U7 1.09e-106 308 74 1 204 3 rsmG Ribosomal RNA small subunit methyltransferase G Yersinia pestis bv. Antiqua (strain Angola)
Q8Z9R9 1.09e-106 308 74 1 204 3 rsmG Ribosomal RNA small subunit methyltransferase G Yersinia pestis
B2K7J3 1.09e-106 308 74 1 204 3 rsmG Ribosomal RNA small subunit methyltransferase G Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C087 1.09e-106 308 74 1 204 3 rsmG Ribosomal RNA small subunit methyltransferase G Yersinia pestis bv. Antiqua (strain Antiqua)
A7FPE8 1.09e-106 308 74 1 204 3 rsmG Ribosomal RNA small subunit methyltransferase G Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
B7NF56 2.62e-105 304 72 2 204 3 rsmG Ribosomal RNA small subunit methyltransferase G Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B1JR33 2.89e-105 304 74 1 204 3 rsmG Ribosomal RNA small subunit methyltransferase G Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q3YVP4 3.81e-105 304 73 2 204 3 rsmG Ribosomal RNA small subunit methyltransferase G Shigella sonnei (strain Ss046)
Q0SYT6 3.81e-105 304 73 2 204 3 rsmG Ribosomal RNA small subunit methyltransferase G Shigella flexneri serotype 5b (strain 8401)
Q31UN9 3.81e-105 304 73 2 204 3 rsmG Ribosomal RNA small subunit methyltransferase G Shigella boydii serotype 4 (strain Sb227)
B2TUN5 3.81e-105 304 73 2 204 3 rsmG Ribosomal RNA small subunit methyltransferase G Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q1R4J2 3.81e-105 304 73 2 204 3 rsmG Ribosomal RNA small subunit methyltransferase G Escherichia coli (strain UTI89 / UPEC)
B6I3X7 3.81e-105 304 73 2 204 3 rsmG Ribosomal RNA small subunit methyltransferase G Escherichia coli (strain SE11)
P0A6U5 3.81e-105 304 73 2 204 1 rsmG Ribosomal RNA small subunit methyltransferase G Escherichia coli (strain K12)
B1IWZ8 3.81e-105 304 73 2 204 3 rsmG Ribosomal RNA small subunit methyltransferase G Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A6U6 3.81e-105 304 73 2 204 3 rsmG Ribosomal RNA small subunit methyltransferase G Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TAW9 3.81e-105 304 73 2 204 3 rsmG Ribosomal RNA small subunit methyltransferase G Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AHS0 3.81e-105 304 73 2 204 3 rsmG Ribosomal RNA small subunit methyltransferase G Escherichia coli O1:K1 / APEC
A8A6K3 3.81e-105 304 73 2 204 3 rsmG Ribosomal RNA small subunit methyltransferase G Escherichia coli O9:H4 (strain HS)
B1X9W8 3.81e-105 304 73 2 204 3 rsmG Ribosomal RNA small subunit methyltransferase G Escherichia coli (strain K12 / DH10B)
C4ZZ18 3.81e-105 304 73 2 204 3 rsmG Ribosomal RNA small subunit methyltransferase G Escherichia coli (strain K12 / MC4100 / BW2952)
B7M596 3.81e-105 304 73 2 204 3 rsmG Ribosomal RNA small subunit methyltransferase G Escherichia coli O8 (strain IAI1)
B7N2H9 3.81e-105 304 73 2 204 3 rsmG Ribosomal RNA small subunit methyltransferase G Escherichia coli O81 (strain ED1a)
B5YXE4 3.81e-105 304 73 2 204 3 rsmG Ribosomal RNA small subunit methyltransferase G Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A6U7 3.81e-105 304 73 2 204 3 rsmG Ribosomal RNA small subunit methyltransferase G Escherichia coli O157:H7
B7L890 3.81e-105 304 73 2 204 3 rsmG Ribosomal RNA small subunit methyltransferase G Escherichia coli (strain 55989 / EAEC)
B7MGG0 3.81e-105 304 73 2 204 3 rsmG Ribosomal RNA small subunit methyltransferase G Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UMK5 3.81e-105 304 73 2 204 3 rsmG Ribosomal RNA small subunit methyltransferase G Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B1LL67 7.76e-105 303 73 2 204 3 rsmG Ribosomal RNA small subunit methyltransferase G Escherichia coli (strain SMS-3-5 / SECEC)
B7NR42 7.76e-105 303 73 2 204 3 rsmG Ribosomal RNA small subunit methyltransferase G Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Q83PJ7 1.19e-104 303 72 2 204 3 rsmG Ribosomal RNA small subunit methyltransferase G Shigella flexneri
B5EZ06 4.78e-104 301 72 2 204 3 rsmG Ribosomal RNA small subunit methyltransferase G Salmonella agona (strain SL483)
P64237 5.34e-104 301 72 2 204 1 rsmG Ribosomal RNA small subunit methyltransferase G Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P64238 5.34e-104 301 72 2 204 3 rsmG Ribosomal RNA small subunit methyltransferase G Salmonella typhi
B5BIP4 5.34e-104 301 72 2 204 3 rsmG Ribosomal RNA small subunit methyltransferase G Salmonella paratyphi A (strain AKU_12601)
A9MXB7 5.34e-104 301 72 2 204 3 rsmG Ribosomal RNA small subunit methyltransferase G Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PJX2 5.34e-104 301 72 2 204 3 rsmG Ribosomal RNA small subunit methyltransferase G Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SYE1 5.34e-104 301 72 2 204 3 rsmG Ribosomal RNA small subunit methyltransferase G Salmonella newport (strain SL254)
B4TAY2 5.34e-104 301 72 2 204 3 rsmG Ribosomal RNA small subunit methyltransferase G Salmonella heidelberg (strain SL476)
B5FN43 5.34e-104 301 72 2 204 3 rsmG Ribosomal RNA small subunit methyltransferase G Salmonella dublin (strain CT_02021853)
Q57HX0 5.34e-104 301 72 2 204 3 rsmG Ribosomal RNA small subunit methyltransferase G Salmonella choleraesuis (strain SC-B67)
C6DJG4 1.76e-103 300 70 1 206 3 rsmG Ribosomal RNA small subunit methyltransferase G Pectobacterium carotovorum subsp. carotovorum (strain PC1)
A8ACP6 2.03e-103 300 72 2 204 3 rsmG Ribosomal RNA small subunit methyltransferase G Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q329S9 2.05e-103 300 72 2 204 3 rsmG Ribosomal RNA small subunit methyltransferase G Shigella dysenteriae serotype 1 (strain Sd197)
C5BF32 2.7e-103 299 70 1 206 3 rsmG Ribosomal RNA small subunit methyltransferase G Edwardsiella ictaluri (strain 93-146)
B4TN41 2.36e-102 297 72 2 204 3 rsmG Ribosomal RNA small subunit methyltransferase G Salmonella schwarzengrund (strain CVM19633)
B7LK85 3.01e-102 296 70 2 204 3 rsmG Ribosomal RNA small subunit methyltransferase G Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
A4WGE7 8.51e-102 295 70 2 204 3 rsmG Ribosomal RNA small subunit methyltransferase G Enterobacter sp. (strain 638)
Q6CYI7 1.35e-101 295 68 1 206 3 rsmG Ribosomal RNA small subunit methyltransferase G Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A7MMW2 4.26e-101 293 70 2 204 3 rsmG Ribosomal RNA small subunit methyltransferase G Cronobacter sakazakii (strain ATCC BAA-894)
A9MJR0 1.05e-100 293 71 2 204 3 rsmG Ribosomal RNA small subunit methyltransferase G Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q2NQ94 3.16e-97 284 68 1 204 3 rsmG Ribosomal RNA small subunit methyltransferase G Sodalis glossinidius (strain morsitans)
B5XZL6 3.05e-96 281 67 2 202 3 rsmG Ribosomal RNA small subunit methyltransferase G Klebsiella pneumoniae (strain 342)
A6TG44 6.29e-96 280 68 2 202 3 rsmG Ribosomal RNA small subunit methyltransferase G Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q6LLF8 4.63e-93 273 63 2 205 3 rsmG Ribosomal RNA small subunit methyltransferase G Photobacterium profundum (strain SS9)
Q12HP1 1.11e-92 272 65 2 204 3 rsmG Ribosomal RNA small subunit methyltransferase G Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q5E1M7 1.47e-92 272 61 1 206 3 rsmG Ribosomal RNA small subunit methyltransferase G Aliivibrio fischeri (strain ATCC 700601 / ES114)
A8G1X5 1.67e-92 272 64 2 201 3 rsmG Ribosomal RNA small subunit methyltransferase G Shewanella sediminis (strain HAW-EB3)
A3QJS0 5.41e-91 268 64 3 206 3 rsmG Ribosomal RNA small subunit methyltransferase G Shewanella loihica (strain ATCC BAA-1088 / PV-4)
A5F469 1.21e-90 267 61 1 206 3 rsmG Ribosomal RNA small subunit methyltransferase G Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
C3LSJ9 2.11e-90 266 60 1 206 3 rsmG Ribosomal RNA small subunit methyltransferase G Vibrio cholerae serotype O1 (strain M66-2)
Q9KNG5 2.11e-90 266 60 1 206 3 rsmG Ribosomal RNA small subunit methyltransferase G Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q7MGH0 3.57e-90 266 61 1 206 3 rsmG Ribosomal RNA small subunit methyltransferase G Vibrio vulnificus (strain YJ016)
Q8DDH8 3.57e-90 266 61 1 206 3 rsmG Ribosomal RNA small subunit methyltransferase G Vibrio vulnificus (strain CMCP6)
Q07VT4 5.21e-90 265 64 2 201 3 rsmG Ribosomal RNA small subunit methyltransferase G Shewanella frigidimarina (strain NCIMB 400)
Q3IK40 1.09e-89 265 63 2 206 3 rsmG Ribosomal RNA small subunit methyltransferase G Pseudoalteromonas translucida (strain TAC 125)
A0KQY8 1.33e-89 265 64 2 202 3 rsmG Ribosomal RNA small subunit methyltransferase G Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
B7VN06 3.08e-89 264 58 1 206 3 rsmG Ribosomal RNA small subunit methyltransferase G Vibrio atlanticus (strain LGP32)
B1KQ44 3.54e-89 263 61 2 201 3 rsmG Ribosomal RNA small subunit methyltransferase G Shewanella woodyi (strain ATCC 51908 / MS32)
B0TQG4 3.58e-89 263 63 2 201 3 rsmG Ribosomal RNA small subunit methyltransferase G Shewanella halifaxensis (strain HAW-EB4)
A4STQ3 6.13e-89 263 64 2 202 3 rsmG Ribosomal RNA small subunit methyltransferase G Aeromonas salmonicida (strain A449)
Q47U39 9.5e-89 262 60 1 204 3 rsmG Ribosomal RNA small subunit methyltransferase G Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q87K99 9.73e-89 263 60 1 206 3 rsmG Ribosomal RNA small subunit methyltransferase G Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A1RQC0 1.07e-88 262 63 2 201 3 rsmG Ribosomal RNA small subunit methyltransferase G Shewanella sp. (strain W3-18-1)
A4YCI8 1.07e-88 262 63 2 201 3 rsmG Ribosomal RNA small subunit methyltransferase G Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A8HAH3 1.18e-88 262 62 2 201 3 rsmG Ribosomal RNA small subunit methyltransferase G Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B8CVV5 1.42e-88 262 62 2 198 3 rsmG Ribosomal RNA small subunit methyltransferase G Shewanella piezotolerans (strain WP3 / JCM 13877)
Q5QZI9 3.23e-88 261 62 2 203 3 rsmG Ribosomal RNA small subunit methyltransferase G Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
A7N0X5 5.54e-88 261 60 1 206 3 rsmG Ribosomal RNA small subunit methyltransferase G Vibrio campbellii (strain ATCC BAA-1116)
A9KX16 8.18e-88 260 63 2 201 3 rsmG Ribosomal RNA small subunit methyltransferase G Shewanella baltica (strain OS195)
A6WUK0 8.18e-88 260 63 2 201 3 rsmG Ribosomal RNA small subunit methyltransferase G Shewanella baltica (strain OS185)
A3DAS4 8.18e-88 260 63 2 201 3 rsmG Ribosomal RNA small subunit methyltransferase G Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8EDW0 8.18e-88 260 63 2 201 3 rsmG Ribosomal RNA small subunit methyltransferase G Shewanella baltica (strain OS223)
Q7VPP8 9.61e-88 259 61 1 202 3 rsmG Ribosomal RNA small subunit methyltransferase G Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q0HD69 1.08e-87 259 63 2 201 3 rsmG Ribosomal RNA small subunit methyltransferase G Shewanella sp. (strain MR-4)
A0KR27 3.01e-87 258 63 2 201 3 rsmG Ribosomal RNA small subunit methyltransferase G Shewanella sp. (strain ANA-3)
Q0HPF1 8.05e-87 257 62 2 201 3 rsmG Ribosomal RNA small subunit methyltransferase G Shewanella sp. (strain MR-7)
B8F6X2 5.33e-86 255 62 1 200 3 rsmG Ribosomal RNA small subunit methyltransferase G Glaesserella parasuis serovar 5 (strain SH0165)
A3N2V2 5.64e-86 255 60 1 203 3 rsmG Ribosomal RNA small subunit methyltransferase G Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q8E8B0 1.01e-85 254 61 2 201 3 rsmG Ribosomal RNA small subunit methyltransferase G Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
B0BRY0 1.37e-85 254 60 1 203 3 rsmG Ribosomal RNA small subunit methyltransferase G Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3H2Q1 1.37e-85 254 60 1 203 3 rsmG Ribosomal RNA small subunit methyltransferase G Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A1SBV0 1.38e-84 252 64 2 203 3 rsmG Ribosomal RNA small subunit methyltransferase G Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
P44728 1.56e-83 249 58 2 204 3 rsmG Ribosomal RNA small subunit methyltransferase G Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UGZ7 1.56e-83 249 58 2 204 3 rsmG Ribosomal RNA small subunit methyltransferase G Haemophilus influenzae (strain PittGG)
Q4QN56 1.56e-83 249 58 2 204 3 rsmG Ribosomal RNA small subunit methyltransferase G Haemophilus influenzae (strain 86-028NP)
P57946 2.56e-83 249 59 3 211 3 rsmG Ribosomal RNA small subunit methyltransferase G Pasteurella multocida (strain Pm70)
A5UA03 5.63e-82 245 58 2 204 3 rsmG Ribosomal RNA small subunit methyltransferase G Haemophilus influenzae (strain PittEE)
Q15MT4 1.28e-79 239 56 3 208 3 rsmG Ribosomal RNA small subunit methyltransferase G Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q65Q00 5.15e-78 235 56 2 205 3 rsmG Ribosomal RNA small subunit methyltransferase G Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
A1T0Z9 6.36e-77 232 62 2 204 3 rsmG Ribosomal RNA small subunit methyltransferase G Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
A6VL65 8.11e-76 230 59 2 204 3 rsmG Ribosomal RNA small subunit methyltransferase G Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
B4RS91 6.39e-75 228 54 3 208 3 rsmG Ribosomal RNA small subunit methyltransferase G Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
B0UWH2 4.14e-74 225 55 2 202 3 rsmG Ribosomal RNA small subunit methyltransferase G Histophilus somni (strain 2336)
Q0I5W5 7.15e-74 225 55 2 202 3 rsmG Ribosomal RNA small subunit methyltransferase G Histophilus somni (strain 129Pt)
Q21DG3 4.87e-69 213 52 2 193 3 rsmG Ribosomal RNA small subunit methyltransferase G Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
A6W3T8 7.12e-66 204 54 4 190 3 rsmG Ribosomal RNA small subunit methyltransferase G Marinomonas sp. (strain MWYL1)
Q48BF5 2.2e-63 198 49 2 202 3 rsmG Ribosomal RNA small subunit methyltransferase G Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q4ZL14 2.82e-63 198 49 2 202 3 rsmG Ribosomal RNA small subunit methyltransferase G Pseudomonas syringae pv. syringae (strain B728a)
Q87TS4 4.01e-63 197 48 2 202 3 rsmG Ribosomal RNA small subunit methyltransferase G Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q2S6N0 5.62e-62 195 45 2 201 3 rsmG Ribosomal RNA small subunit methyltransferase G Hahella chejuensis (strain KCTC 2396)
Q9HT10 1.26e-61 194 48 4 207 3 rsmG Ribosomal RNA small subunit methyltransferase G Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
B7V7A1 1.26e-61 194 48 4 207 3 rsmG Ribosomal RNA small subunit methyltransferase G Pseudomonas aeruginosa (strain LESB58)
Q02DE4 1.64e-61 193 48 4 209 3 rsmG Ribosomal RNA small subunit methyltransferase G Pseudomonas aeruginosa (strain UCBPP-PA14)
A6VF42 2.17e-60 191 49 4 201 3 rsmG Ribosomal RNA small subunit methyltransferase G Pseudomonas aeruginosa (strain PA7)
Q31DK9 5.96e-60 189 49 2 185 3 rsmG Ribosomal RNA small subunit methyltransferase G Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
A4VS72 4.48e-59 187 51 3 193 3 rsmG Ribosomal RNA small subunit methyltransferase G Stutzerimonas stutzeri (strain A1501)
A4Y197 8.72e-59 186 48 4 212 3 rsmG Ribosomal RNA small subunit methyltransferase G Pseudomonas mendocina (strain ymp)
P0A125 1.71e-57 183 44 4 205 3 rsmG Ribosomal RNA small subunit methyltransferase G Pseudomonas putida
P0A124 1.71e-57 183 44 4 205 3 rsmG Ribosomal RNA small subunit methyltransferase G Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5WBB3 1.71e-57 183 44 4 205 3 rsmG Ribosomal RNA small subunit methyltransferase G Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q3K431 3.77e-57 182 46 2 202 3 rsmG Ribosomal RNA small subunit methyltransferase G Pseudomonas fluorescens (strain Pf0-1)
B0KRB8 2.44e-56 180 43 4 205 3 rsmG Ribosomal RNA small subunit methyltransferase G Pseudomonas putida (strain GB-1)
Q3J6M1 5.19e-56 179 46 2 191 3 rsmG Ribosomal RNA small subunit methyltransferase G Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
B1JFV1 2.15e-55 178 43 4 205 3 rsmG Ribosomal RNA small subunit methyltransferase G Pseudomonas putida (strain W619)
Q0BJM7 2.52e-54 176 45 3 208 3 rsmG Ribosomal RNA small subunit methyltransferase G Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q5ZRJ1 4.59e-54 174 47 3 173 3 rsmG Ribosomal RNA small subunit methyltransferase G Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
B1YQK3 1.46e-53 174 45 3 208 3 rsmG Ribosomal RNA small subunit methyltransferase G Burkholderia ambifaria (strain MC40-6)
Q4K3A0 1.9e-53 173 46 2 201 3 rsmG Ribosomal RNA small subunit methyltransferase G Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q1I2H7 2.36e-53 173 46 3 204 3 rsmG Ribosomal RNA small subunit methyltransferase G Pseudomonas entomophila (strain L48)
A4JA23 3.6e-53 173 45 3 208 3 rsmG Ribosomal RNA small subunit methyltransferase G Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q5WSS3 4e-53 172 47 3 173 3 rsmG Ribosomal RNA small subunit methyltransferase G Legionella pneumophila (strain Lens)
Q5X0Z7 4.36e-53 172 47 3 173 3 rsmG Ribosomal RNA small subunit methyltransferase G Legionella pneumophila (strain Paris)
A5II63 4.41e-53 172 47 3 173 3 rsmG Ribosomal RNA small subunit methyltransferase G Legionella pneumophila (strain Corby)
Q39KY8 6.34e-53 172 44 3 208 3 rsmG Ribosomal RNA small subunit methyltransferase G Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
C1D5H2 6.98e-53 171 45 2 204 3 rsmG Ribosomal RNA small subunit methyltransferase G Laribacter hongkongensis (strain HLHK9)
Q0VKW4 1.11e-52 171 46 5 208 3 rsmG Ribosomal RNA small subunit methyltransferase G Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
B4RR25 1.51e-52 171 42 2 202 3 rsmG Ribosomal RNA small subunit methyltransferase G Neisseria gonorrhoeae (strain NCCP11945)
Q5F5X7 1.51e-52 171 42 2 202 3 rsmG Ribosomal RNA small subunit methyltransferase G Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
B4E582 2.69e-52 171 44 3 207 3 rsmG Ribosomal RNA small subunit methyltransferase G Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
Q1BR98 3.2e-52 170 46 3 195 3 rsmG Ribosomal RNA small subunit methyltransferase G Burkholderia orbicola (strain AU 1054)
A0K2X1 3.2e-52 170 46 3 195 3 rsmG Ribosomal RNA small subunit methyltransferase G Burkholderia cenocepacia (strain HI2424)
A1U7I4 3.62e-52 170 45 2 200 3 rsmG Ribosomal RNA small subunit methyltransferase G Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
A9AJF2 4.24e-52 170 44 3 198 3 rsmG Ribosomal RNA small subunit methyltransferase G Burkholderia multivorans (strain ATCC 17616 / 249)
Q9K1G3 5.33e-52 169 42 2 202 3 rsmG Ribosomal RNA small subunit methyltransferase G Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q9JX38 6.85e-52 169 41 2 202 3 rsmG Ribosomal RNA small subunit methyltransferase G Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9M3R8 6.85e-52 169 40 2 203 3 rsmG Ribosomal RNA small subunit methyltransferase G Neisseria meningitidis serogroup C (strain 053442)
B0TW44 7.28e-52 169 40 4 207 3 rsmG Ribosomal RNA small subunit methyltransferase G Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
A0Q444 7.67e-52 169 40 4 207 3 rsmG Ribosomal RNA small subunit methyltransferase G Francisella tularensis subsp. novicida (strain U112)
A1KRM2 8.6e-52 169 41 2 202 3 rsmG Ribosomal RNA small subunit methyltransferase G Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
B3PIT7 9.82e-52 169 45 4 216 3 rsmG Ribosomal RNA small subunit methyltransferase G Cellvibrio japonicus (strain Ueda107)
Q0BP72 1.68e-51 168 40 4 207 3 rsmG Ribosomal RNA small subunit methyltransferase G Francisella tularensis subsp. holarctica (strain OSU18)
Q2A5Y4 1.68e-51 168 40 4 207 3 rsmG Ribosomal RNA small subunit methyltransferase G Francisella tularensis subsp. holarctica (strain LVS)
A7N992 1.68e-51 168 40 4 207 3 rsmG Ribosomal RNA small subunit methyltransferase G Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
Q5NEF0 2.15e-51 167 40 4 207 3 rsmG Ribosomal RNA small subunit methyltransferase G Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q14FV3 2.15e-51 167 40 4 207 3 rsmG Ribosomal RNA small subunit methyltransferase G Francisella tularensis subsp. tularensis (strain FSC 198)
Q7P0A5 2.54e-51 167 44 4 204 3 rsmG Ribosomal RNA small subunit methyltransferase G Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
A1K1Q5 2.87e-51 167 43 3 184 3 rsmG Ribosomal RNA small subunit methyltransferase G Azoarcus sp. (strain BH72)
Q478A1 3.59e-51 167 41 2 204 3 rsmG Ribosomal RNA small subunit methyltransferase G Dechloromonas aromatica (strain RCB)
Q3SF56 4.88e-51 167 44 2 183 3 rsmG Ribosomal RNA small subunit methyltransferase G Thiobacillus denitrificans (strain ATCC 25259)
Q2Y5B5 1.69e-50 166 40 2 207 3 rsmG Ribosomal RNA small subunit methyltransferase G Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q0A4L8 3.88e-50 165 42 3 196 3 rsmG Ribosomal RNA small subunit methyltransferase G Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
A4J072 5.67e-50 164 39 4 207 3 rsmG Ribosomal RNA small subunit methyltransferase G Francisella tularensis subsp. tularensis (strain WY96-3418)
Q60CS4 2.86e-49 162 47 4 173 3 rsmG Ribosomal RNA small subunit methyltransferase G Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q5P4J7 2.94e-49 162 41 5 213 3 rsmG Ribosomal RNA small subunit methyltransferase G Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q2STD8 1.11e-47 159 41 4 210 3 rsmG Ribosomal RNA small subunit methyltransferase G Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
A6T481 1.27e-47 158 39 4 200 3 rsmG Ribosomal RNA small subunit methyltransferase G Janthinobacterium sp. (strain Marseille)
Q0ADD7 4.19e-47 157 41 3 198 3 rsmG Ribosomal RNA small subunit methyltransferase G Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
A1VIB2 2.06e-46 155 39 3 214 3 rsmG Ribosomal RNA small subunit methyltransferase G Polaromonas naphthalenivorans (strain CJ2)
A4GAI1 2.32e-46 155 40 4 200 3 rsmG Ribosomal RNA small subunit methyltransferase G Herminiimonas arsenicoxydans
Q8XU66 4e-46 154 40 3 216 3 rsmG Ribosomal RNA small subunit methyltransferase G Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q2NXD0 4.63e-46 154 43 3 179 3 rsmG Ribosomal RNA small subunit methyltransferase G Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q13SP1 6.55e-46 154 41 3 208 3 rsmG Ribosomal RNA small subunit methyltransferase G Paraburkholderia xenovorans (strain LB400)
Q5GU13 7.15e-46 154 42 3 179 3 rsmG Ribosomal RNA small subunit methyltransferase G Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SU21 7.15e-46 154 42 3 179 3 rsmG Ribosomal RNA small subunit methyltransferase G Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q1QSC0 2.24e-45 152 45 1 172 3 rsmG Ribosomal RNA small subunit methyltransferase G Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q82S79 3.49e-45 152 40 4 212 3 rsmG Ribosomal RNA small subunit methyltransferase G Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q1GXM0 9.87e-45 150 40 3 205 3 rsmG Ribosomal RNA small subunit methyltransferase G Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
A3NF53 1.09e-44 151 40 3 209 3 rsmG Ribosomal RNA small subunit methyltransferase G Burkholderia pseudomallei (strain 668)
B9M9W4 1.13e-44 151 36 3 219 3 rsmG Ribosomal RNA small subunit methyltransferase G Acidovorax ebreus (strain TPSY)
A1W208 1.47e-44 150 38 3 204 3 rsmG Ribosomal RNA small subunit methyltransferase G Acidovorax sp. (strain JS42)
Q8PF23 3e-44 149 41 3 179 3 rsmG Ribosomal RNA small subunit methyltransferase G Xanthomonas axonopodis pv. citri (strain 306)
Q3BML8 3.53e-44 149 41 3 179 3 rsmG Ribosomal RNA small subunit methyltransferase G Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
A3P103 5.13e-44 149 40 3 209 3 rsmG Ribosomal RNA small subunit methyltransferase G Burkholderia pseudomallei (strain 1106a)
Q3JXU8 7.32e-44 149 40 3 209 3 rsmG Ribosomal RNA small subunit methyltransferase G Burkholderia pseudomallei (strain 1710b)
A1V8U2 7.32e-44 149 40 3 209 3 rsmG Ribosomal RNA small subunit methyltransferase G Burkholderia mallei (strain SAVP1)
Q62FS7 7.32e-44 149 40 3 209 3 rsmG Ribosomal RNA small subunit methyltransferase G Burkholderia mallei (strain ATCC 23344)
Q63PG9 8.06e-44 149 40 3 209 3 rsmG Ribosomal RNA small subunit methyltransferase G Burkholderia pseudomallei (strain K96243)
A2S6K9 8.06e-44 149 40 3 209 3 rsmG Ribosomal RNA small subunit methyltransferase G Burkholderia mallei (strain NCTC 10229)
A3MQI8 8.06e-44 149 40 3 209 3 rsmG Ribosomal RNA small subunit methyltransferase G Burkholderia mallei (strain NCTC 10247)
B0VMY0 8.84e-44 148 43 3 194 3 rsmG Ribosomal RNA small subunit methyltransferase G Acinetobacter baumannii (strain SDF)
B0VCZ6 9.44e-44 148 43 3 194 3 rsmG Ribosomal RNA small subunit methyltransferase G Acinetobacter baumannii (strain AYE)
A3M4Y3 9.44e-44 148 43 3 194 3 rsmG Ribosomal RNA small subunit methyltransferase G Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B2HZC3 9.44e-44 148 43 3 194 3 rsmG Ribosomal RNA small subunit methyltransferase G Acinetobacter baumannii (strain ACICU)
B7I508 9.44e-44 148 43 3 194 3 rsmG Ribosomal RNA small subunit methyltransferase G Acinetobacter baumannii (strain AB0057)
B7H3N1 9.44e-44 148 43 3 194 3 rsmG Ribosomal RNA small subunit methyltransferase G Acinetobacter baumannii (strain AB307-0294)
Q6F9W7 1.57e-43 147 42 3 205 3 rsmG Ribosomal RNA small subunit methyltransferase G Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
B1XYL2 4.21e-43 147 39 4 194 3 rsmG Ribosomal RNA small subunit methyltransferase G Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
Q87D24 5.77e-43 146 40 2 181 3 rsmG Ribosomal RNA small subunit methyltransferase G Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I4Q1 5.77e-43 146 40 2 181 3 rsmG Ribosomal RNA small subunit methyltransferase G Xylella fastidiosa (strain M23)
Q9PC50 1.42e-42 145 40 2 181 3 rsmG Ribosomal RNA small subunit methyltransferase G Xylella fastidiosa (strain 9a5c)
Q12HF1 2.34e-42 145 37 3 214 3 rsmG Ribosomal RNA small subunit methyltransferase G Polaromonas sp. (strain JS666 / ATCC BAA-500)
A2SMF0 3.65e-42 144 42 3 176 3 rsmG Ribosomal RNA small subunit methyltransferase G Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
A1AVB2 6.06e-42 143 35 4 192 3 rsmG Ribosomal RNA small subunit methyltransferase G Ruthia magnifica subsp. Calyptogena magnifica
B2FNF9 6.66e-42 143 39 2 179 3 rsmG Ribosomal RNA small subunit methyltransferase G Stenotrophomonas maltophilia (strain K279a)
B4SNP6 7.58e-42 143 39 2 179 3 rsmG Ribosomal RNA small subunit methyltransferase G Stenotrophomonas maltophilia (strain R551-3)
B6J2B9 9.11e-42 143 36 4 193 3 rsmG Ribosomal RNA small subunit methyltransferase G Coxiella burnetii (strain CbuG_Q212)
P94614 9.41e-42 143 36 4 193 3 rsmG Ribosomal RNA small subunit methyltransferase G Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NBA9 9.41e-42 143 36 4 193 3 rsmG Ribosomal RNA small subunit methyltransferase G Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KBS7 1.92e-41 142 37 4 193 3 rsmG Ribosomal RNA small subunit methyltransferase G Coxiella burnetii (strain Dugway 5J108-111)
B6J8V2 4.01e-41 141 37 4 193 3 rsmG Ribosomal RNA small subunit methyltransferase G Coxiella burnetii (strain CbuK_Q154)
Q8P3N0 8.27e-41 140 41 3 178 3 rsmG Ribosomal RNA small subunit methyltransferase G Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UP54 8.27e-41 140 41 3 178 3 rsmG Ribosomal RNA small subunit methyltransferase G Xanthomonas campestris pv. campestris (strain 8004)
Q1QBW5 1.45e-40 141 40 5 189 3 rsmG Ribosomal RNA small subunit methyltransferase G Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
B0RYS0 3.88e-40 139 41 3 178 3 rsmG Ribosomal RNA small subunit methyltransferase G Xanthomonas campestris pv. campestris (strain B100)
Q2L2S3 1.04e-39 138 37 3 208 3 rsmG Ribosomal RNA small subunit methyltransferase G Bordetella avium (strain 197N)
Q7W0S9 6.81e-39 136 39 6 217 3 rsmG Ribosomal RNA small subunit methyltransferase G Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W2I0 6.81e-39 136 39 6 217 3 rsmG Ribosomal RNA small subunit methyltransferase G Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q21QL4 7.43e-39 136 36 5 222 3 rsmG Ribosomal RNA small subunit methyltransferase G Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
A1TI79 8.91e-39 136 36 6 227 3 rsmG Ribosomal RNA small subunit methyltransferase G Paracidovorax citrulli (strain AAC00-1)
Q46VX0 1.25e-38 135 37 5 221 3 rsmG Ribosomal RNA small subunit methyltransferase G Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q4FS37 1.87e-38 135 39 2 187 3 rsmG Ribosomal RNA small subunit methyltransferase G Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
A0PX79 4.24e-38 134 32 5 213 3 rsmG Ribosomal RNA small subunit methyltransferase G Clostridium novyi (strain NT)
A9IJ46 6.35e-38 134 37 4 214 3 rsmG Ribosomal RNA small subunit methyltransferase G Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
A1WSY4 1.54e-37 132 39 2 192 3 rsmG Ribosomal RNA small subunit methyltransferase G Halorhodospira halophila (strain DSM 244 / SL1)
A4J9R9 2.29e-37 132 34 5 220 3 rsmG Ribosomal RNA small subunit methyltransferase G Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
A5WFA2 4.34e-37 131 39 4 191 3 rsmG Ribosomal RNA small subunit methyltransferase G Psychrobacter sp. (strain PRwf-1)
Q0K5L7 8.66e-36 128 36 5 221 3 rsmG Ribosomal RNA small subunit methyltransferase G Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
A1WGT3 9.08e-36 129 35 3 211 3 rsmG Ribosomal RNA small subunit methyltransferase G Verminephrobacter eiseniae (strain EF01-2)
Q97CW4 5.87e-35 126 35 6 213 3 rsmG Ribosomal RNA small subunit methyltransferase G Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q7WRF0 1.1e-34 125 38 6 208 3 rsmG Ribosomal RNA small subunit methyltransferase G Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q24MA0 1.36e-34 125 35 2 179 3 rsmG Ribosomal RNA small subunit methyltransferase G Desulfitobacterium hafniense (strain Y51)
C3KWJ3 1.51e-34 125 32 5 213 3 rsmG Ribosomal RNA small subunit methyltransferase G Clostridium botulinum (strain 657 / Type Ba4)
C1FP29 1.79e-34 125 32 5 213 3 rsmG Ribosomal RNA small subunit methyltransferase G Clostridium botulinum (strain Kyoto / Type A2)
Q82YY1 2.41e-33 122 32 5 217 3 rsmG Ribosomal RNA small subunit methyltransferase G Enterococcus faecalis (strain ATCC 700802 / V583)
A5I814 2.72e-33 122 34 4 188 3 rsmG Ribosomal RNA small subunit methyltransferase G Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FPL8 2.72e-33 122 34 4 188 3 rsmG Ribosomal RNA small subunit methyltransferase G Clostridium botulinum (strain ATCC 19397 / Type A)
A7GJN7 5.58e-33 121 33 4 189 3 rsmG Ribosomal RNA small subunit methyltransferase G Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
B1IHR7 5.58e-33 121 33 4 189 3 rsmG Ribosomal RNA small subunit methyltransferase G Clostridium botulinum (strain Okra / Type B1)
Q899S0 7.29e-33 121 32 5 212 3 rsmG Ribosomal RNA small subunit methyltransferase G Clostridium tetani (strain Massachusetts / E88)
A1BJ05 1.76e-32 119 32 3 201 3 rsmG Ribosomal RNA small subunit methyltransferase G Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
B0S3V0 3.8e-32 119 36 5 209 3 rsmG Ribosomal RNA small subunit methyltransferase G Finegoldia magna (strain ATCC 29328 / DSM 20472 / WAL 2508)
A4SCT8 4.46e-32 118 35 2 173 3 rsmG Ribosomal RNA small subunit methyltransferase G Chlorobium phaeovibrioides (strain DSM 265 / 1930)
B2TRH8 7.67e-32 118 33 5 204 3 rsmG Ribosomal RNA small subunit methyltransferase G Clostridium botulinum (strain Eklund 17B / Type B)
A6M3M3 1.14e-31 118 34 6 204 3 rsmG Ribosomal RNA small subunit methyltransferase G Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
A6TXE3 1.25e-31 118 38 5 178 3 rsmG Ribosomal RNA small subunit methyltransferase G Alkaliphilus metalliredigens (strain QYMF)
B1KUB0 1.42e-31 117 33 4 188 3 rsmG Ribosomal RNA small subunit methyltransferase G Clostridium botulinum (strain Loch Maree / Type A3)
A3DHY6 1.51e-31 117 39 4 166 3 rsmG Ribosomal RNA small subunit methyltransferase G Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
B2V1U8 1.54e-31 117 33 5 204 3 rsmG Ribosomal RNA small subunit methyltransferase G Clostridium botulinum (strain Alaska E43 / Type E3)
A5N449 1.87e-31 117 31 7 217 3 rsmG Ribosomal RNA small subunit methyltransferase G Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B9DXR9 1.87e-31 117 31 7 217 3 rsmG Ribosomal RNA small subunit methyltransferase G Clostridium kluyveri (strain NBRC 12016)
A5EXK3 2.28e-31 116 35 5 184 3 rsmG Ribosomal RNA small subunit methyltransferase G Dichelobacter nodosus (strain VCS1703A)
C0ZA63 2.67e-31 117 33 6 217 3 rsmG Ribosomal RNA small subunit methyltransferase G Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
Q8XH32 3.21e-31 117 33 5 206 3 rsmG Ribosomal RNA small subunit methyltransferase G Clostridium perfringens (strain 13 / Type A)
Q0TLZ7 3.21e-31 117 33 5 206 3 rsmG Ribosomal RNA small subunit methyltransferase G Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
B9DI97 4.72e-31 116 35 5 210 3 rsmG Ribosomal RNA small subunit methyltransferase G Staphylococcus carnosus (strain TM300)
Q0SPQ5 4.92e-31 116 33 5 206 3 rsmG Ribosomal RNA small subunit methyltransferase G Clostridium perfringens (strain SM101 / Type A)
Q1LHJ9 5.13e-31 116 38 5 221 3 rsmG Ribosomal RNA small subunit methyltransferase G Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
B3EGW1 6.07e-31 115 37 2 172 3 rsmG Ribosomal RNA small subunit methyltransferase G Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
Q3B6D4 1.66e-30 115 35 2 179 3 rsmG Ribosomal RNA small subunit methyltransferase G Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
A8YXD7 2.66e-30 114 34 5 211 3 rsmG Ribosomal RNA small subunit methyltransferase G Lactobacillus helveticus (strain DPC 4571)
Q4L2Z4 3.66e-30 114 36 4 187 3 rsmG Ribosomal RNA small subunit methyltransferase G Staphylococcus haemolyticus (strain JCSC1435)
Q8KAK0 6.39e-30 113 35 2 173 3 rsmG Ribosomal RNA small subunit methyltransferase G Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q5HS34 8.76e-30 113 34 6 211 3 rsmG Ribosomal RNA small subunit methyltransferase G Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
B1HPM1 1.11e-29 113 33 4 194 3 rsmG Ribosomal RNA small subunit methyltransferase G Lysinibacillus sphaericus (strain C3-41)
Q5FI43 1.11e-29 113 34 6 212 3 rsmG Ribosomal RNA small subunit methyltransferase G Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
B9E8Z2 1.27e-29 112 37 6 186 3 rsmG Ribosomal RNA small subunit methyltransferase G Macrococcus caseolyticus (strain JCSC5402)
Q8CMN7 2.14e-29 112 35 8 211 3 rsmG Ribosomal RNA small subunit methyltransferase G Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
A8MKR7 2.21e-29 112 34 8 219 3 rsmG Ribosomal RNA small subunit methyltransferase G Alkaliphilus oremlandii (strain OhILAs)
Q3APK2 7.46e-29 110 32 2 172 3 rsmG Ribosomal RNA small subunit methyltransferase G Chlorobium chlorochromatii (strain CaD3)
Q65CN3 3.34e-28 109 31 5 215 3 rsmG Ribosomal RNA small subunit methyltransferase G Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q8NUF9 3.56e-28 108 36 4 187 3 rsmG Ribosomal RNA small subunit methyltransferase G Staphylococcus aureus (strain MW2)
A8YYR9 3.56e-28 108 36 4 187 3 rsmG Ribosomal RNA small subunit methyltransferase G Staphylococcus aureus (strain USA300 / TCH1516)
Q6G5W6 3.56e-28 108 36 4 187 3 rsmG Ribosomal RNA small subunit methyltransferase G Staphylococcus aureus (strain MSSA476)
A6QKK0 3.56e-28 108 36 4 187 3 rsmG Ribosomal RNA small subunit methyltransferase G Staphylococcus aureus (strain Newman)
Q5HCI5 3.56e-28 108 36 4 187 3 rsmG Ribosomal RNA small subunit methyltransferase G Staphylococcus aureus (strain COL)
Q2FUQ4 3.56e-28 108 36 4 187 3 rsmG Ribosomal RNA small subunit methyltransferase G Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FDF0 3.56e-28 108 36 4 187 3 rsmG Ribosomal RNA small subunit methyltransferase G Staphylococcus aureus (strain USA300)
A9KLX7 4.52e-28 108 37 4 162 3 rsmG Ribosomal RNA small subunit methyltransferase G Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
A4SUS4 5.45e-28 108 34 5 199 3 rsmG Ribosomal RNA small subunit methyltransferase G Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
P64240 7.26e-28 108 35 4 187 3 rsmG Ribosomal RNA small subunit methyltransferase G Staphylococcus aureus (strain N315)
P64239 7.26e-28 108 35 4 187 3 rsmG Ribosomal RNA small subunit methyltransferase G Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5IWD5 7.26e-28 108 35 4 187 3 rsmG Ribosomal RNA small subunit methyltransferase G Staphylococcus aureus (strain JH9)
A6U593 7.26e-28 108 35 4 187 3 rsmG Ribosomal RNA small subunit methyltransferase G Staphylococcus aureus (strain JH1)
A7X7A5 7.26e-28 108 35 4 187 3 rsmG Ribosomal RNA small subunit methyltransferase G Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q39ZT2 7.81e-28 107 32 5 213 3 rsmG Ribosomal RNA small subunit methyltransferase G Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q6GD94 8.16e-28 108 36 4 187 3 rsmG Ribosomal RNA small subunit methyltransferase G Staphylococcus aureus (strain MRSA252)
Q2YZC0 1.01e-27 107 36 4 187 3 rsmG Ribosomal RNA small subunit methyltransferase G Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q040U0 1.1e-27 107 30 5 206 3 rsmG Ribosomal RNA small subunit methyltransferase G Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
A8FJF8 1.16e-27 107 31 6 215 3 rsmG Ribosomal RNA small subunit methyltransferase G Bacillus pumilus (strain SAFR-032)
A5CY44 1.22e-27 107 30 5 220 3 rsmG Ribosomal RNA small subunit methyltransferase G Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
B4SC71 1.23e-27 107 35 2 156 3 rsmG Ribosomal RNA small subunit methyltransferase G Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
Q5WAG5 1.73e-27 107 32 4 193 3 rsmG Ribosomal RNA small subunit methyltransferase G Shouchella clausii (strain KSM-K16)
A2RK93 1.81e-27 107 32 9 218 3 rsmG Ribosomal RNA small subunit methyltransferase G Lactococcus lactis subsp. cremoris (strain MG1363)
Q02YJ6 2.51e-27 107 31 8 215 3 rsmG Ribosomal RNA small subunit methyltransferase G Lactococcus lactis subsp. cremoris (strain SK11)
Q74HM3 3.61e-27 106 30 5 205 3 rsmG Ribosomal RNA small subunit methyltransferase G Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q1WRS8 6.98e-27 105 30 6 208 3 rsmG Ribosomal RNA small subunit methyltransferase G Ligilactobacillus salivarius (strain UCC118)
A8AVJ7 7.56e-27 105 33 4 192 3 rsmG Ribosomal RNA small subunit methyltransferase G Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
B1VAK6 9.96e-27 104 35 3 168 3 rsmG Ribosomal RNA small subunit methyltransferase G Phytoplasma australiense
B1YGA6 1.63e-26 104 31 5 215 3 rsmG Ribosomal RNA small subunit methyltransferase G Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
A4XN49 1.78e-26 105 29 5 215 3 rsmG Ribosomal RNA small subunit methyltransferase G Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
A3CLJ1 2.01e-26 104 33 4 192 3 rsmG Ribosomal RNA small subunit methyltransferase G Streptococcus sanguinis (strain SK36)
A0LYD2 2.23e-26 103 36 2 146 3 rsmG Ribosomal RNA small subunit methyltransferase G Christiangramia forsetii (strain DSM 17595 / CGMCC 1.15422 / KT0803)
P25813 2.28e-26 104 30 5 215 1 rsmG Ribosomal RNA small subunit methyltransferase G Bacillus subtilis (strain 168)
Q630C0 2.59e-26 104 33 5 180 3 rsmG Ribosomal RNA small subunit methyltransferase G Bacillus cereus (strain ZK / E33L)
Q814F8 2.88e-26 104 33 5 180 3 rsmG Ribosomal RNA small subunit methyltransferase G Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B7H7A0 2.88e-26 104 33 5 180 3 rsmG Ribosomal RNA small subunit methyltransferase G Bacillus cereus (strain B4264)
B7IST2 2.88e-26 104 33 5 180 3 rsmG Ribosomal RNA small subunit methyltransferase G Bacillus cereus (strain G9842)
Q6HAF4 3.41e-26 103 33 5 180 3 rsmG Ribosomal RNA small subunit methyltransferase G Bacillus thuringiensis subsp. konkukian (strain 97-27)
B9IT40 3.41e-26 103 33 5 180 3 rsmG Ribosomal RNA small subunit methyltransferase G Bacillus cereus (strain Q1)
C1ER75 3.41e-26 103 33 5 180 3 rsmG Ribosomal RNA small subunit methyltransferase G Bacillus cereus (strain 03BB102)
Q72WU5 3.41e-26 103 33 5 180 3 rsmG Ribosomal RNA small subunit methyltransferase G Bacillus cereus (strain ATCC 10987 / NRS 248)
B7JIK9 3.41e-26 103 33 5 180 3 rsmG Ribosomal RNA small subunit methyltransferase G Bacillus cereus (strain AH820)
Q81JH4 3.41e-26 103 33 5 180 3 rsmG Ribosomal RNA small subunit methyltransferase G Bacillus anthracis
A0RLR0 3.41e-26 103 33 5 180 3 rsmG Ribosomal RNA small subunit methyltransferase G Bacillus thuringiensis (strain Al Hakam)
C3LGT9 3.41e-26 103 33 5 180 3 rsmG Ribosomal RNA small subunit methyltransferase G Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P3F3 3.41e-26 103 33 5 180 3 rsmG Ribosomal RNA small subunit methyltransferase G Bacillus anthracis (strain A0248)
Q49UI6 3.88e-26 103 37 8 215 3 rsmG Ribosomal RNA small subunit methyltransferase G Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q71VW1 5.56e-26 103 31 3 188 3 rsmG Ribosomal RNA small subunit methyltransferase G Listeria monocytogenes serotype 4b (strain F2365)
C4L001 5.8e-26 103 28 5 215 3 rsmG Ribosomal RNA small subunit methyltransferase G Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
Q8Y3N3 6.31e-26 103 31 3 188 3 rsmG Ribosomal RNA small subunit methyltransferase G Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
C1L0D6 6.72e-26 103 31 3 188 3 rsmG Ribosomal RNA small subunit methyltransferase G Listeria monocytogenes serotype 4b (strain CLIP80459)
B0K5N2 7.72e-26 103 34 6 198 3 rsmG Ribosomal RNA small subunit methyltransferase G Thermoanaerobacter sp. (strain X514)
B7HZG8 9.74e-26 102 33 4 179 3 rsmG Ribosomal RNA small subunit methyltransferase G Bacillus cereus (strain AH187)
Q8EKU4 9.84e-26 102 33 4 180 3 rsmG Ribosomal RNA small subunit methyltransferase G Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
A7NPB9 1.01e-25 102 32 5 206 3 rsmG Ribosomal RNA small subunit methyltransferase G Roseiflexus castenholzii (strain DSM 13941 / HLO8)
Q9CFX1 1.15e-25 102 32 9 216 3 rsmG Ribosomal RNA small subunit methyltransferase G Lactococcus lactis subsp. lactis (strain IL1403)
Q03NV0 1.18e-25 102 31 4 216 3 rsmG Ribosomal RNA small subunit methyltransferase G Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q03ZA4 1.19e-25 102 36 4 176 3 rsmG Ribosomal RNA small subunit methyltransferase G Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
B0K8H7 1.3e-25 102 34 6 198 3 rsmG Ribosomal RNA small subunit methyltransferase G Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
C6DYR8 1.38e-25 101 30 5 202 3 rsmG Ribosomal RNA small subunit methyltransferase G Geobacter sp. (strain M21)
B8DD12 1.55e-25 102 31 3 188 3 rsmG Ribosomal RNA small subunit methyltransferase G Listeria monocytogenes serotype 4a (strain HCC23)
A9VTL8 1.74e-25 102 33 5 180 3 rsmG Ribosomal RNA small subunit methyltransferase G Bacillus mycoides (strain KBAB4)
Q926V6 1.84e-25 102 29 5 213 3 rsmG Ribosomal RNA small subunit methyltransferase G Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q03DH7 1.88e-25 102 29 5 217 3 rsmG Ribosomal RNA small subunit methyltransferase G Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
Q1G8A5 1.94e-25 102 31 5 210 3 rsmG Ribosomal RNA small subunit methyltransferase G Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
Q047S1 2.2e-25 102 31 5 210 3 rsmG Ribosomal RNA small subunit methyltransferase G Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
B1MX30 2.27e-25 101 36 5 177 3 rsmG Ribosomal RNA small subunit methyltransferase G Leuconostoc citreum (strain KM20)
A7GVP5 2.27e-25 101 33 4 180 3 rsmG Ribosomal RNA small subunit methyltransferase G Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q9K5M8 3.29e-25 101 31 5 209 3 rsmG Ribosomal RNA small subunit methyltransferase G Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q38ZR1 4.02e-25 101 31 5 213 3 rsmG Ribosomal RNA small subunit methyltransferase G Latilactobacillus sakei subsp. sakei (strain 23K)
C5D9Y5 5.82e-25 100 29 5 214 3 rsmG Ribosomal RNA small subunit methyltransferase G Geobacillus sp. (strain WCH70)
O67522 8.2e-25 99 33 5 172 3 rsmG Ribosomal RNA small subunit methyltransferase G Aquifex aeolicus (strain VF5)
A4ITW9 1.04e-24 100 31 7 218 3 rsmG Ribosomal RNA small subunit methyltransferase G Geobacillus thermodenitrificans (strain NG80-2)
Q6YQV6 1.1e-24 99 32 5 198 3 rsmG Ribosomal RNA small subunit methyltransferase G Onion yellows phytoplasma (strain OY-M)
B2G582 1.26e-24 99 31 7 217 3 rsmG Ribosomal RNA small subunit methyltransferase G Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A5VHQ2 1.26e-24 99 31 7 217 3 rsmG Ribosomal RNA small subunit methyltransferase G Limosilactobacillus reuteri (strain DSM 20016)
C1CR21 1.75e-24 99 32 4 187 3 rsmG Ribosomal RNA small subunit methyltransferase G Streptococcus pneumoniae (strain Taiwan19F-14)
Q97QD4 1.75e-24 99 32 4 187 1 rsmG Ribosomal RNA small subunit methyltransferase G Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
C1C7R5 1.75e-24 99 32 4 187 3 rsmG Ribosomal RNA small subunit methyltransferase G Streptococcus pneumoniae (strain 70585)
B5E522 1.75e-24 99 32 4 187 3 rsmG Ribosomal RNA small subunit methyltransferase G Streptococcus pneumoniae serotype 19F (strain G54)
Q7M9J8 1.77e-24 98 37 4 180 3 rsmG Ribosomal RNA small subunit methyltransferase G Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
A0AMC5 1.8e-24 99 31 3 188 3 rsmG Ribosomal RNA small subunit methyltransferase G Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
C1CEP0 1.8e-24 99 32 4 187 3 rsmG Ribosomal RNA small subunit methyltransferase G Streptococcus pneumoniae (strain JJA)
B8ZJU9 1.8e-24 99 32 4 187 3 rsmG Ribosomal RNA small subunit methyltransferase G Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
A5UVE3 2.84e-24 99 30 5 207 3 rsmG Ribosomal RNA small subunit methyltransferase G Roseiflexus sp. (strain RS-1)
Q5LDN0 3.31e-24 97 36 2 135 3 rsmG Ribosomal RNA small subunit methyltransferase G Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
A5FJ42 5.71e-24 97 30 5 195 3 rsmG Ribosomal RNA small subunit methyltransferase G Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / BCRC 14874 / CCUG 350202 / NBRC 14942 / NCIMB 11054 / UW101)
Q64UQ5 5.93e-24 97 36 2 135 3 rsmG Ribosomal RNA small subunit methyltransferase G Bacteroides fragilis (strain YCH46)
B8JDK2 6.33e-24 97 32 5 178 3 rsmG Ribosomal RNA small subunit methyltransferase G Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
Q1IVQ3 6.36e-24 97 38 4 160 3 rsmG Ribosomal RNA small subunit methyltransferase G Koribacter versatilis (strain Ellin345)
C1CL20 7.9e-24 97 31 4 187 3 rsmG Ribosomal RNA small subunit methyltransferase G Streptococcus pneumoniae (strain P1031)
Q8DPH3 7.9e-24 97 31 4 187 3 rsmG Ribosomal RNA small subunit methyltransferase G Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q04K39 7.9e-24 97 31 4 187 3 rsmG Ribosomal RNA small subunit methyltransferase G Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q2NJ22 8.13e-24 97 31 4 188 3 rsmG Ribosomal RNA small subunit methyltransferase G Aster yellows witches'-broom phytoplasma (strain AYWB)
C0R0Y0 1.15e-23 96 28 4 192 3 rsmG Ribosomal RNA small subunit methyltransferase G Brachyspira hyodysenteriae (strain ATCC 49526 / WA1)
Q48960 1.16e-23 97 31 5 192 3 rsmG Ribosomal RNA small subunit methyltransferase G Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
Q6A5B2 1.21e-23 96 33 6 198 3 rsmG Ribosomal RNA small subunit methyltransferase G Cutibacterium acnes (strain DSM 16379 / KPA171202)
C0M821 1.38e-23 97 30 4 197 3 rsmG Ribosomal RNA small subunit methyltransferase G Streptococcus equi subsp. equi (strain 4047)
Q6F0F5 1.5e-23 97 34 3 162 3 rsmG Ribosomal RNA small subunit methyltransferase G Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1)
C0MG47 1.6e-23 97 30 4 197 3 rsmG Ribosomal RNA small subunit methyltransferase G Streptococcus equi subsp. zooepidemicus (strain H70)
B9DTP3 2.6e-23 96 31 7 202 3 rsmG Ribosomal RNA small subunit methyltransferase G Streptococcus uberis (strain ATCC BAA-854 / 0140J)
B4U4T4 2.8e-23 96 30 4 197 3 rsmG Ribosomal RNA small subunit methyltransferase G Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
A7ZAV9 2.88e-23 96 30 6 218 3 rsmG Ribosomal RNA small subunit methyltransferase G Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q5XDS2 2.92e-23 96 28 5 193 3 rsmG Ribosomal RNA small subunit methyltransferase G Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
A6L982 3.15e-23 95 31 3 177 3 rsmG Ribosomal RNA small subunit methyltransferase G Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
A9NEC5 3.46e-23 95 33 5 180 3 rsmG Ribosomal RNA small subunit methyltransferase G Acholeplasma laidlawii (strain PG-8A)
Q2IHR2 3.83e-23 95 38 6 147 3 rsmG Ribosomal RNA small subunit methyltransferase G Anaeromyxobacter dehalogenans (strain 2CP-C)
Q5KU59 4.26e-23 95 30 4 213 3 rsmG Ribosomal RNA small subunit methyltransferase G Geobacillus kaustophilus (strain HTA426)
Q1JDG1 5.26e-23 95 28 5 193 3 rsmG Ribosomal RNA small subunit methyltransferase G Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q8A8M2 6.5e-23 94 34 2 136 3 rsmG Ribosomal RNA small subunit methyltransferase G Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q03CJ9 8.22e-23 95 30 5 205 3 rsmG Ribosomal RNA small subunit methyltransferase G Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
A2RGB9 9.38e-23 94 28 5 193 3 rsmG Ribosomal RNA small subunit methyltransferase G Streptococcus pyogenes serotype M5 (strain Manfredo)
Q8P2K1 9.38e-23 94 28 5 193 3 rsmG Ribosomal RNA small subunit methyltransferase G Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q67J35 9.79e-23 95 34 7 196 3 rsmG Ribosomal RNA small subunit methyltransferase G Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
A6GWQ2 9.86e-23 94 29 4 173 3 rsmG Ribosomal RNA small subunit methyltransferase G Flavobacterium psychrophilum (strain ATCC 49511 / DSM 21280 / CIP 103535 / JIP02/86)
P0DF45 9.99e-23 94 28 5 193 3 rsmG Ribosomal RNA small subunit methyltransferase G Streptococcus pyogenes serotype M3 (strain SSI-1)
Q48V72 9.99e-23 94 28 5 193 3 rsmG Ribosomal RNA small subunit methyltransferase G Streptococcus pyogenes serotype M28 (strain MGAS6180)
P0DF44 9.99e-23 94 28 5 193 3 rsmG Ribosomal RNA small subunit methyltransferase G Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
B4UKF8 1.01e-22 94 31 5 176 3 rsmG Ribosomal RNA small subunit methyltransferase G Anaeromyxobacter sp. (strain K)
B5XJV1 1.1e-22 94 28 5 193 3 rsmG Ribosomal RNA small subunit methyltransferase G Streptococcus pyogenes serotype M49 (strain NZ131)
Q1JII3 1.18e-22 94 29 5 180 3 rsmG Ribosomal RNA small subunit methyltransferase G Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1J8D8 1.33e-22 94 28 5 193 3 rsmG Ribosomal RNA small subunit methyltransferase G Streptococcus pyogenes serotype M4 (strain MGAS10750)
B9MQF1 1.41e-22 94 30 5 200 3 rsmG Ribosomal RNA small subunit methyltransferase G Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
A4VTE0 2.74e-22 93 34 6 184 3 rsmG Ribosomal RNA small subunit methyltransferase G Streptococcus suis (strain 05ZYH33)
A4VZL7 2.74e-22 93 34 6 184 3 rsmG Ribosomal RNA small subunit methyltransferase G Streptococcus suis (strain 98HAH33)
Q9A1D7 3.42e-22 93 28 5 193 3 rsmG Ribosomal RNA small subunit methyltransferase G Streptococcus pyogenes serotype M1
Q3M6A1 4.78e-22 93 28 5 206 3 rsmG Ribosomal RNA small subunit methyltransferase G Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q8DY64 5.09e-22 92 32 3 150 3 rsmG Ribosomal RNA small subunit methyltransferase G Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q1JND4 5.31e-22 92 28 5 193 3 rsmG Ribosomal RNA small subunit methyltransferase G Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q7MV10 5.78e-22 92 33 2 141 3 rsmG Ribosomal RNA small subunit methyltransferase G Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
Q8E3T0 7.13e-22 92 32 3 150 3 rsmG Ribosomal RNA small subunit methyltransferase G Streptococcus agalactiae serotype III (strain NEM316)
Q3JZQ7 7.83e-22 92 32 3 150 3 rsmG Ribosomal RNA small subunit methyltransferase G Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q88T09 9.07e-22 92 28 4 206 3 rsmG Ribosomal RNA small subunit methyltransferase G Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
A4T4S9 9.07e-22 92 35 4 169 3 rsmG Ribosomal RNA small subunit methyltransferase G Mycolicibacterium gilvum (strain PYR-GCK)
B2HNT4 1.06e-21 92 36 4 152 3 rsmG Ribosomal RNA small subunit methyltransferase G Mycobacterium marinum (strain ATCC BAA-535 / M)
A5G9V1 1.09e-21 91 29 5 200 3 rsmG Ribosomal RNA small subunit methyltransferase G Geotalea uraniireducens (strain Rf4)
A3Q8S0 1.12e-21 91 37 5 153 3 rsmG Ribosomal RNA small subunit methyltransferase G Mycobacterium sp. (strain JLS)
Q5M5Y2 1.27e-21 92 29 5 202 3 rsmG Ribosomal RNA small subunit methyltransferase G Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5M1E6 1.27e-21 92 29 5 202 3 rsmG Ribosomal RNA small subunit methyltransferase G Streptococcus thermophilus (strain CNRZ 1066)
Q9RYD6 1.81e-21 92 31 7 199 3 rsmG Ribosomal RNA small subunit methyltransferase G Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q1B0S6 1.94e-21 91 37 5 153 3 rsmG Ribosomal RNA small subunit methyltransferase G Mycobacterium sp. (strain MCS)
A1U8R4 1.94e-21 91 37 5 153 3 rsmG Ribosomal RNA small subunit methyltransferase G Mycobacterium sp. (strain KMS)
A6QC07 2.01e-21 90 35 4 184 3 rsmG Ribosomal RNA small subunit methyltransferase G Sulfurovum sp. (strain NBC37-1)
Q2RFJ0 2.3e-21 91 32 5 197 3 rsmG Ribosomal RNA small subunit methyltransferase G Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q93D95 3.4e-21 90 29 5 206 3 rsmG Ribosomal RNA small subunit methyltransferase G Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q03MB7 3.7e-21 90 28 5 202 3 rsmG Ribosomal RNA small subunit methyltransferase G Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
B2GF22 4e-21 90 31 8 208 3 rsmG Ribosomal RNA small subunit methyltransferase G Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
A0LE46 4.01e-21 90 34 5 163 3 rsmG Ribosomal RNA small subunit methyltransferase G Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
Q3ZXE0 4.08e-21 90 30 6 222 3 rsmG Ribosomal RNA small subunit methyltransferase G Dehalococcoides mccartyi (strain CBDB1)
A5FR82 4.29e-21 90 30 6 222 3 rsmG Ribosomal RNA small subunit methyltransferase G Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1)
P9WGW9 4.63e-21 90 37 4 152 1 rsmG Ribosomal RNA small subunit methyltransferase G Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGW8 4.63e-21 90 37 4 152 3 rsmG Ribosomal RNA small subunit methyltransferase G Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U9P7 4.63e-21 90 37 4 152 3 rsmG Ribosomal RNA small subunit methyltransferase G Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
A1KEG3 4.63e-21 90 37 4 152 3 rsmG1 Ribosomal RNA small subunit methyltransferase G Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P59964 4.63e-21 90 37 4 152 3 rsmG Ribosomal RNA small subunit methyltransferase G Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q1AR63 5.06e-21 90 37 6 182 3 rsmG Ribosomal RNA small subunit methyltransferase G Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
Q39PR1 5.73e-21 89 28 6 213 3 rsmG Ribosomal RNA small subunit methyltransferase G Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
A1AV41 6.04e-21 89 30 3 180 3 rsmG Ribosomal RNA small subunit methyltransferase G Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
Q50203 7.18e-21 90 41 5 146 3 rsmG Ribosomal RNA small subunit methyltransferase G Mycobacterium leprae (strain TN)
O54571 7.74e-21 89 34 3 172 1 rsmG Ribosomal RNA small subunit methyltransferase G Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q8R6L0 7.99e-21 89 32 5 182 3 rsmG Ribosomal RNA small subunit methyltransferase G Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
B8ZTN3 8.78e-21 90 41 5 146 3 rsmG Ribosomal RNA small subunit methyltransferase G Mycobacterium leprae (strain Br4923)
B2J5Q6 9.44e-21 89 29 6 207 3 rsmG Ribosomal RNA small subunit methyltransferase G Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
Q9L7M3 1.13e-20 89 40 6 167 3 rsmG Ribosomal RNA small subunit methyltransferase G Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Q73JU8 1.17e-20 89 31 7 216 3 rsmG Ribosomal RNA small subunit methyltransferase G Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q46J33 1.54e-20 89 32 5 184 3 rsmG Ribosomal RNA small subunit methyltransferase G Prochlorococcus marinus (strain NATL2A)
A1TI25 1.68e-20 88 32 4 175 3 rsmG Ribosomal RNA small subunit methyltransferase G Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
Q2LY85 1.95e-20 89 30 5 204 3 rsmG Ribosomal RNA small subunit methyltransferase G Syntrophus aciditrophicus (strain SB)
A6L4P5 2.1e-20 88 28 3 169 3 rsmG Ribosomal RNA small subunit methyltransferase G Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
Q04HG5 2.19e-20 88 33 2 145 3 rsmG Ribosomal RNA small subunit methyltransferase G Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
A0QND0 2.26e-20 89 39 6 167 3 rsmG Ribosomal RNA small subunit methyltransferase G Mycobacterium avium (strain 104)
Q30TL7 2.68e-20 87 36 2 137 3 rsmG Ribosomal RNA small subunit methyltransferase G Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
Q82FE3 3.88e-20 88 36 3 158 3 rsmG Ribosomal RNA small subunit methyltransferase G Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
A2C4M0 4.06e-20 88 32 5 184 3 rsmG Ribosomal RNA small subunit methyltransferase G Prochlorococcus marinus (strain NATL1A)
Q2S6G7 4.23e-20 87 34 2 136 3 rsmG Ribosomal RNA small subunit methyltransferase G Salinibacter ruber (strain DSM 13855 / M31)
Q11VU7 4.61e-20 87 31 2 138 3 rsmG Ribosomal RNA small subunit methyltransferase G Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)
A1SQV5 4.82e-20 88 37 3 150 3 rsmG Ribosomal RNA small subunit methyltransferase G Nocardioides sp. (strain ATCC BAA-499 / JS614)
A0LLH7 5.59e-20 87 37 3 145 3 rsmG1 Ribosomal RNA small subunit methyltransferase G 1 Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
Q1CVH7 6.29e-20 87 34 4 171 3 rsmG Ribosomal RNA small subunit methyltransferase G Myxococcus xanthus (strain DK1622)
Q6MMJ3 8.3e-20 87 29 7 214 3 rsmG2 Ribosomal RNA small subunit methyltransferase G 2 Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
Q8YSA7 1.11e-19 87 27 5 206 3 rsmG Ribosomal RNA small subunit methyltransferase G Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
A8F3S3 1.81e-19 85 30 5 189 3 rsmG Ribosomal RNA small subunit methyltransferase G Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO)
Q1IVV7 1.89e-19 86 33 7 187 3 rsmG Ribosomal RNA small subunit methyltransferase G Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
Q8NL53 1.96e-19 85 36 3 159 3 rsmG Ribosomal RNA small subunit methyltransferase G Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
A4QIE3 2.94e-19 85 35 3 159 3 rsmG Ribosomal RNA small subunit methyltransferase G Corynebacterium glutamicum (strain R)
Q5N2N4 4.62e-19 85 31 6 184 3 rsmG Ribosomal RNA small subunit methyltransferase G Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q31RM0 4.62e-19 85 31 6 184 3 rsmG Ribosomal RNA small subunit methyltransferase G Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
A0R7J5 4.62e-19 85 35 6 156 3 rsmG Ribosomal RNA small subunit methyltransferase G Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
C1D0A7 5.04e-19 85 29 5 194 3 rsmG Ribosomal RNA small subunit methyltransferase G Deinococcus deserti (strain DSM 17065 / CIP 109153 / LMG 22923 / VCD115)
A0PX66 5.14e-19 83 36 4 144 3 rsmG Ribosomal RNA small subunit methyltransferase G Mycobacterium ulcerans (strain Agy99)
Q72H89 5.55e-19 85 35 6 188 3 rsmG Ribosomal RNA small subunit methyltransferase G Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
Q8FSV1 6.78e-19 84 37 4 155 3 rsmG Ribosomal RNA small subunit methyltransferase G Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
B8H8Y9 8.28e-19 84 34 4 159 3 rsmG Ribosomal RNA small subunit methyltransferase G Pseudarthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / CIP 107037 / JCM 12360 / KCTC 9906 / NCIMB 13794 / A6)
Q3Z8E1 1.29e-18 84 30 6 198 3 rsmG Ribosomal RNA small subunit methyltransferase G Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195)
B8G6Y3 1.55e-18 83 29 7 202 3 rsmG Ribosomal RNA small subunit methyltransferase G Chloroflexus aggregans (strain MD-66 / DSM 9485)
A3PNS5 1.91e-18 82 31 3 143 3 rsmG Ribosomal RNA small subunit methyltransferase G Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
A9WGI4 2.13e-18 83 33 4 168 3 rsmG Ribosomal RNA small subunit methyltransferase G Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
Q6ABV7 2.96e-18 82 36 2 131 3 rsmG Ribosomal RNA small subunit methyltransferase G Leifsonia xyli subsp. xyli (strain CTCB07)
Q10Y54 3.21e-18 83 28 7 207 3 rsmG Ribosomal RNA small subunit methyltransferase G Trichodesmium erythraeum (strain IMS101)
Q8RI89 4.74e-18 82 34 5 151 3 rsmG Ribosomal RNA small subunit methyltransferase G Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
A6Q1W3 4.82e-18 81 31 2 144 3 rsmG Ribosomal RNA small subunit methyltransferase G Nitratiruptor sp. (strain SB155-2)
Q8DI86 5.26e-18 82 30 8 204 3 rsmG Ribosomal RNA small subunit methyltransferase G Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q1GCL8 5.93e-18 81 33 4 146 3 rsmG Ribosomal RNA small subunit methyltransferase G Ruegeria sp. (strain TM1040)
Q01NF9 6.01e-18 81 32 2 128 3 rsmG Ribosomal RNA small subunit methyltransferase G Solibacter usitatus (strain Ellin6076)
Q3IYH5 7.45e-18 81 30 3 143 3 rsmG Ribosomal RNA small subunit methyltransferase G Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
B0C384 7.74e-18 82 29 7 227 3 rsmG Ribosomal RNA small subunit methyltransferase G Acaryochloris marina (strain MBIC 11017)
Q3AG54 9.3e-18 81 31 5 216 3 rsmG Ribosomal RNA small subunit methyltransferase G Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
A9HE10 9.92e-18 80 31 4 158 3 rsmG Ribosomal RNA small subunit methyltransferase G Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
A8EU69 1.02e-17 80 31 4 173 3 rsmG Ribosomal RNA small subunit methyltransferase G Aliarcobacter butzleri (strain RM4018)
Q16CZ7 1.08e-17 80 33 5 165 3 rsmG Ribosomal RNA small subunit methyltransferase G Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
B5YFF7 1.66e-17 80 29 5 174 3 rsmG Ribosomal RNA small subunit methyltransferase G Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12)
A7HIY6 1.97e-17 80 33 7 187 3 rsmG Ribosomal RNA small subunit methyltransferase G Anaeromyxobacter sp. (strain Fw109-5)
A4XDK0 2.55e-17 80 35 5 157 3 rsmG Ribosomal RNA small subunit methyltransferase G Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / JCM 13857 / NBRC 105044 / CNB-440)
Q6KH77 2.55e-17 80 28 6 189 3 rsmG Ribosomal RNA small subunit methyltransferase G Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711)
Q2JMA3 3e-17 80 29 6 192 3 rsmG Ribosomal RNA small subunit methyltransferase G Synechococcus sp. (strain JA-2-3B'a(2-13))
Q6NE98 3.06e-17 80 36 4 155 3 rsmG Ribosomal RNA small subunit methyltransferase G Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
B0RDP8 3.15e-17 79 32 2 148 3 rsmG Ribosomal RNA small subunit methyltransferase G Clavibacter sepedonicus
Q9ZM61 3.29e-17 79 32 4 153 3 rsmG Ribosomal RNA small subunit methyltransferase G Helicobacter pylori (strain J99 / ATCC 700824)
Q2GC39 4.21e-17 79 31 3 170 3 rsmG Ribosomal RNA small subunit methyltransferase G Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
Q47K77 5.3e-17 79 37 3 142 3 rsmG Ribosomal RNA small subunit methyltransferase G Thermobifida fusca (strain YX)
A0K2M2 6.79e-17 79 32 4 159 3 rsmG Ribosomal RNA small subunit methyltransferase G Arthrobacter sp. (strain FB24)
Q746Q5 6.84e-17 79 27 5 196 3 rsmG Ribosomal RNA small subunit methyltransferase G Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_15455
Feature type CDS
Gene rsmG
Product 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG
Location 17538 - 18164 (strand: 1)
Length 627 (nucleotides) / 208 (amino acids)

Contig

Accession contig_21
Length 81362 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2064
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF02527 rRNA small subunit methyltransferase G

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0357 Translation, ribosomal structure and biogenesis (J) J 16S rRNA G527 N7-methylase RsmG (former glucose-inhibited division protein B)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03501 16S rRNA (guanine527-N7)-methyltransferase [EC:2.1.1.170] - -

Protein Sequence

MSDLQQQLSALLRSADIRLTDQQKQQLTGYVEMLHKWNKAYNLTSVRQPEQMLVRHIMDSIVVEPYLTGRRFIDVGTGPGLPGVPLAIVRPDSHFVLLDSLGKRVRFLKQVQHELGLSNIEPVQSRVEEYQGEPFDGVISRAFASLDDMLSWCHHLPVPETGRFFALKGSVPEEELTRLPEGISLVSVEKLVVPQLDEQRHLVILKAN

Flanking regions ( +/- flanking 50bp)

TGCTGGTCTGGCTGAAAAAGCAGGGCCTTCTGCGGAGGAGTGCGTAACGGATGAGTGATTTACAGCAACAACTTTCCGCGCTGCTGCGCAGTGCGGATATCCGGCTGACCGATCAGCAGAAACAGCAGCTGACCGGCTATGTGGAGATGCTCCACAAGTGGAACAAAGCCTATAACCTGACTTCTGTCCGCCAGCCGGAACAGATGCTGGTGCGTCATATCATGGACAGTATCGTGGTCGAACCGTATCTGACCGGCCGCCGGTTTATTGATGTCGGCACCGGCCCCGGGCTTCCCGGCGTGCCGCTGGCGATTGTCCGCCCGGACTCTCACTTTGTCCTGCTCGACAGCCTGGGTAAGCGTGTACGCTTCCTGAAACAGGTACAGCATGAACTGGGGCTGAGCAACATCGAACCGGTTCAGAGCCGCGTGGAAGAGTATCAGGGCGAACCATTTGACGGGGTTATTAGTCGTGCATTTGCATCACTGGATGATATGCTCAGTTGGTGTCATCACCTGCCGGTACCGGAAACCGGGCGCTTTTTTGCACTGAAAGGCAGTGTGCCGGAAGAGGAATTAACCCGGTTACCGGAGGGGATTTCTCTCGTCAGTGTCGAAAAACTGGTCGTGCCGCAACTTGACGAGCAGCGCCATCTGGTGATTCTTAAAGCAAATTGAGTTTGCTGTACGTCAAAAAACAGAAATATTTTTAAGGGGACGGAGTCAGC