Homologs in group_2054

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_11110 EHELCC_11110 100.0 Morganella morganii S2 nqrB NADH:ubiquinone reductase (Na(+)-transporting) subunit B
NLDBIP_11455 NLDBIP_11455 100.0 Morganella morganii S4 nqrB NADH:ubiquinone reductase (Na(+)-transporting) subunit B
LHKJJB_11315 LHKJJB_11315 100.0 Morganella morganii S3 nqrB NADH:ubiquinone reductase (Na(+)-transporting) subunit B
HKOGLL_09925 HKOGLL_09925 100.0 Morganella morganii S5 nqrB NADH:ubiquinone reductase (Na(+)-transporting) subunit B
F4V73_RS12310 F4V73_RS12310 94.7 Morganella psychrotolerans - NADH:ubiquinone reductase (Na(+)-transporting) subunit B
PMI_RS01690 PMI_RS01690 83.7 Proteus mirabilis HI4320 - NADH:ubiquinone reductase (Na(+)-transporting) subunit B

Distribution of the homologs in the orthogroup group_2054

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2054

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q8ZBZ1 0.0 699 81 0 412 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Yersinia pestis
B5Y1F0 0.0 688 79 0 412 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Klebsiella pneumoniae (strain 342)
A6T522 0.0 687 79 0 412 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q7MIC8 0.0 666 76 0 411 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Vibrio vulnificus (strain YJ016)
Q8DBJ5 0.0 666 76 0 411 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Vibrio vulnificus (strain CMCP6)
Q75R63 0.0 659 76 0 411 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Vibrio anguillarum
Q56587 0.0 656 76 0 411 1 nqrB Na(+)-translocating NADH-quinone reductase subunit B Vibrio alginolyticus
Q87MA7 0.0 655 75 0 411 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q9KPS2 0.0 655 75 0 411 1 nqrB Na(+)-translocating NADH-quinone reductase subunit B Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F5X0 0.0 655 75 0 411 1 nqrB Na(+)-translocating NADH-quinone reductase subunit B Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q9RFW0 0.0 645 75 0 409 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Vibrio campbellii (strain ATCC BAA-1116)
Q9CLB0 0.0 644 76 1 411 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Pasteurella multocida (strain Pm70)
Q9JVP9 0.0 636 75 2 412 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q7VNU8 0.0 634 74 2 411 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q9K0M4 0.0 632 74 2 412 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
O05011 0.0 602 69 1 411 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UFW9 0.0 602 69 1 411 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Haemophilus influenzae (strain PittGG)
A5UAX2 0.0 602 69 1 411 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Haemophilus influenzae (strain PittEE)
Q4QP23 0.0 602 69 1 411 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Haemophilus influenzae (strain 86-028NP)
Q15YQ5 0.0 543 66 3 411 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
A4VMV3 0.0 530 64 5 413 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Stutzerimonas stutzeri (strain A1501)
A4XSP4 0.0 530 64 5 413 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Pseudomonas mendocina (strain ymp)
A6V398 0.0 528 64 5 413 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Pseudomonas aeruginosa (strain PA7)
Q9HZK7 0.0 528 64 5 413 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02PG2 0.0 528 64 5 413 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Pseudomonas aeruginosa (strain UCBPP-PA14)
B7UZT8 0.0 528 64 5 413 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Pseudomonas aeruginosa (strain LESB58)
Q1QX85 2.69e-178 506 62 4 412 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
C1DR03 8.32e-177 501 63 4 411 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q5L6C0 4.26e-44 163 43 6 232 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Chlamydia abortus (strain DSM 27085 / S26/3)
Q5L6C0 1.54e-29 123 43 1 155 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Chlamydia abortus (strain DSM 27085 / S26/3)
Q9Z8B6 9.76e-44 162 40 6 235 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Chlamydia pneumoniae
Q9Z8B6 1.32e-29 123 45 1 154 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Chlamydia pneumoniae
Q253X4 1.4e-43 162 43 6 232 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Chlamydia felis (strain Fe/C-56)
Q253X4 3.93e-30 124 43 1 155 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Chlamydia felis (strain Fe/C-56)
Q823P2 3.03e-43 161 41 6 234 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)
Q823P2 7.01e-23 103 42 1 155 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)
Q9PKB6 3.22e-41 155 39 4 228 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Chlamydia muridarum (strain MoPn / Nigg)
Q9PKB6 7.41e-26 112 42 1 155 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Chlamydia muridarum (strain MoPn / Nigg)
O84280 6.62e-41 154 40 3 213 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
O84280 1.3e-25 112 42 1 155 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
Q3KM84 6.62e-41 154 40 3 213 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13)
Q3KM84 1.3e-25 112 42 1 155 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13)
B0BBQ9 1.21e-40 154 40 3 213 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis)
B0BBQ9 1.22e-25 112 42 1 155 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis)
B0B7J4 1.21e-40 154 40 3 213 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Chlamydia trachomatis serovar L2 (strain ATCC VR-902B / DSM 19102 / 434/Bu)
B0B7J4 1.22e-25 112 42 1 155 3 nqrB Na(+)-translocating NADH-quinone reductase subunit B Chlamydia trachomatis serovar L2 (strain ATCC VR-902B / DSM 19102 / 434/Bu)
D8GR67 8.32e-29 118 30 4 252 2 rnfD Proton-translocating ferredoxin:NAD(+) oxidoreductase complex subunit D Clostridium ljungdahlii (strain ATCC 55383 / DSM 13528 / PETC)
A4XS50 3.02e-27 114 30 7 272 3 rnfD Ion-translocating oxidoreductase complex subunit D Pseudomonas mendocina (strain ymp)
A1TZ62 4.08e-26 111 29 7 296 3 rnfD Ion-translocating oxidoreductase complex subunit D Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q87MX1 4.41e-26 111 30 7 278 3 rnfD Ion-translocating oxidoreductase complex subunit D Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B2VEQ4 1.51e-25 109 29 6 290 3 rnfD Ion-translocating oxidoreductase complex subunit D Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A1SSX2 1.7e-24 106 28 7 276 3 rnfD Ion-translocating oxidoreductase complex subunit D Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q7MM84 2.12e-24 106 29 9 286 3 rnfD Ion-translocating oxidoreductase complex subunit D Vibrio vulnificus (strain YJ016)
Q8D887 2.12e-24 106 29 9 286 3 rnfD Ion-translocating oxidoreductase complex subunit D Vibrio vulnificus (strain CMCP6)
B8D721 2.38e-24 106 25 8 310 3 rnfD Ion-translocating oxidoreductase complex subunit D Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57216 2.38e-24 106 25 8 310 3 rnfD Ion-translocating oxidoreductase complex subunit D Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D8R7 2.38e-24 106 25 8 310 3 rnfD Ion-translocating oxidoreductase complex subunit D Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
Q6D4W1 3.14e-24 105 28 5 281 3 rnfD Ion-translocating oxidoreductase complex subunit D Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
C6DH14 6.81e-24 105 27 5 281 3 rnfD Ion-translocating oxidoreductase complex subunit D Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q0VP38 7.94e-24 104 31 9 283 3 rnfD Ion-translocating oxidoreductase complex subunit D Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
H6LC31 1.21e-23 103 35 7 239 1 rnfD Na(+)-translocating ferredoxin:NAD(+) oxidoreductase complex subunit D Acetobacterium woodii (strain ATCC 29683 / DSM 1030 / JCM 2381 / KCTC 1655 / WB1)
A0KX82 2.19e-23 103 29 8 281 3 rnfD Ion-translocating oxidoreductase complex subunit D Shewanella sp. (strain ANA-3)
Q66AG7 2.41e-23 103 30 6 275 3 rnfD Ion-translocating oxidoreductase complex subunit D Yersinia pseudotuberculosis serotype I (strain IP32953)
Q0HVF8 2.44e-23 103 29 8 281 3 rnfD Ion-translocating oxidoreductase complex subunit D Shewanella sp. (strain MR-7)
Q0HIH7 2.44e-23 103 29 8 281 3 rnfD Ion-translocating oxidoreductase complex subunit D Shewanella sp. (strain MR-4)
A1JM66 3.14e-23 103 30 6 275 3 rnfD Ion-translocating oxidoreductase complex subunit D Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B7UVX0 4.12e-23 102 32 9 271 3 rnfD Ion-translocating oxidoreductase complex subunit D Pseudomonas aeruginosa (strain LESB58)
Q8EE78 4.69e-23 102 29 8 277 3 rnfD Ion-translocating oxidoreductase complex subunit D Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q081P4 4.81e-23 102 27 7 288 3 rnfD Ion-translocating oxidoreductase complex subunit D Shewanella frigidimarina (strain NCIMB 400)
A7FHZ5 5.27e-23 102 30 6 275 3 rnfD Ion-translocating oxidoreductase complex subunit D Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A4Y6I7 5.99e-23 102 27 5 283 3 rnfD Ion-translocating oxidoreductase complex subunit D Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A1RJZ5 6.05e-23 102 27 5 283 3 rnfD Ion-translocating oxidoreductase complex subunit D Shewanella sp. (strain W3-18-1)
A7MML0 7.99e-23 102 29 7 284 3 rnfD Ion-translocating oxidoreductase complex subunit D Cronobacter sakazakii (strain ATCC BAA-894)
Q8KA19 9.77e-23 101 25 8 305 3 rnfD Ion-translocating oxidoreductase complex subunit D Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
B8E551 1.21e-22 101 28 6 286 3 rnfD Ion-translocating oxidoreductase complex subunit D Shewanella baltica (strain OS223)
A6WN15 1.7e-22 100 28 6 286 3 rnfD Ion-translocating oxidoreductase complex subunit D Shewanella baltica (strain OS185)
Q7VNT3 1.71e-22 100 28 5 270 3 rnfD Ion-translocating oxidoreductase complex subunit D Haemophilus ducreyi (strain 35000HP / ATCC 700724)
A9L0J8 1.8e-22 100 28 6 286 3 rnfD Ion-translocating oxidoreductase complex subunit D Shewanella baltica (strain OS195)
Q9HYB7 1.86e-22 100 31 9 271 3 rnfD Ion-translocating oxidoreductase complex subunit D Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02QY1 1.86e-22 100 31 9 271 3 rnfD Ion-translocating oxidoreductase complex subunit D Pseudomonas aeruginosa (strain UCBPP-PA14)
B7URX1 2.26e-22 100 27 8 305 3 rsxD Ion-translocating oxidoreductase complex subunit D Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B7NU03 2.37e-22 100 27 8 305 3 rsxD Ion-translocating oxidoreductase complex subunit D Escherichia coli O7:K1 (strain IAI39 / ExPEC)
A8AH11 2.55e-22 100 28 6 276 3 rnfD Ion-translocating oxidoreductase complex subunit D Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A3QEN7 2.7e-22 100 28 7 287 3 rnfD Ion-translocating oxidoreductase complex subunit D Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q8ZED2 2.87e-22 100 30 6 275 3 rnfD Ion-translocating oxidoreductase complex subunit D Yersinia pestis
A5F2R1 3.19e-22 100 30 8 275 1 rnfD Ion-translocating oxidoreductase complex subunit D Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
C3LTR2 3.99e-22 100 30 8 275 3 rnfD Ion-translocating oxidoreductase complex subunit D Vibrio cholerae serotype O1 (strain M66-2)
Q9KT89 3.99e-22 100 30 8 275 3 rnfD Ion-translocating oxidoreductase complex subunit D Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
B7MV12 4.05e-22 100 27 8 305 3 rsxD Ion-translocating oxidoreductase complex subunit D Escherichia coli O81 (strain ED1a)
A4SNP8 4.14e-22 100 28 10 293 3 rnfD Ion-translocating oxidoreductase complex subunit D Aeromonas salmonicida (strain A449)
A8FUX7 4.43e-22 99 27 7 288 3 rnfD Ion-translocating oxidoreductase complex subunit D Shewanella sediminis (strain HAW-EB3)
Q0THJ7 4.51e-22 99 27 8 305 3 rsxD Ion-translocating oxidoreductase complex subunit D Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q12N27 5.23e-22 99 26 8 309 3 rnfD Ion-translocating oxidoreductase complex subunit D Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
A7ZM90 6.03e-22 99 27 8 305 3 rsxD Ion-translocating oxidoreductase complex subunit D Escherichia coli O139:H28 (strain E24377A / ETEC)
Q1RBG6 6.65e-22 99 27 8 305 3 rsxD Ion-translocating oxidoreductase complex subunit D Escherichia coli (strain UTI89 / UPEC)
A1ABH5 6.65e-22 99 27 8 305 3 rsxD Ion-translocating oxidoreductase complex subunit D Escherichia coli O1:K1 / APEC
B7M9Y4 6.65e-22 99 27 8 305 3 rsxD Ion-translocating oxidoreductase complex subunit D Escherichia coli O45:K1 (strain S88 / ExPEC)
B7LQP0 6.91e-22 99 28 9 304 3 rsxD Ion-translocating oxidoreductase complex subunit D Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
P76182 6.91e-22 99 27 7 305 1 rsxD Ion-translocating oxidoreductase complex subunit D Escherichia coli (strain K12)
A8A0H3 6.91e-22 99 27 7 305 3 rsxD Ion-translocating oxidoreductase complex subunit D Escherichia coli O9:H4 (strain HS)
B1XFU2 6.91e-22 99 27 7 305 3 rsxD Ion-translocating oxidoreductase complex subunit D Escherichia coli (strain K12 / DH10B)
C4ZY93 6.91e-22 99 27 7 305 3 rsxD Ion-translocating oxidoreductase complex subunit D Escherichia coli (strain K12 / MC4100 / BW2952)
Q9EVN4 7.09e-22 99 31 7 282 3 rnfD Ion-translocating oxidoreductase complex subunit D Stutzerimonas stutzeri
Q0T4E7 7.26e-22 99 28 9 305 3 rsxD Ion-translocating oxidoreductase complex subunit D Shigella flexneri serotype 5b (strain 8401)
A0KLJ5 8.34e-22 99 28 11 298 3 rnfD Ion-translocating oxidoreductase complex subunit D Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q32FE3 8.39e-22 99 28 9 305 3 rsxD Ion-translocating oxidoreductase complex subunit D Shigella dysenteriae serotype 1 (strain Sd197)
B7NB84 8.47e-22 99 28 9 305 3 rsxD Ion-translocating oxidoreductase complex subunit D Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B5Z464 8.47e-22 99 28 9 305 3 rsxD Ion-translocating oxidoreductase complex subunit D Escherichia coli O157:H7 (strain EC4115 / EHEC)
P58325 8.47e-22 99 28 9 305 3 rsxD Ion-translocating oxidoreductase complex subunit D Escherichia coli O157:H7
Q83KY5 1.01e-21 99 28 9 305 3 rsxD Ion-translocating oxidoreductase complex subunit D Shigella flexneri
Q320Y7 1.1e-21 98 28 9 305 3 rsxD Ion-translocating oxidoreductase complex subunit D Shigella boydii serotype 4 (strain Sb227)
B2U2C9 1.1e-21 98 28 9 305 3 rsxD Ion-translocating oxidoreductase complex subunit D Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q3Z1Y5 1.2e-21 98 28 9 305 3 rsxD Ion-translocating oxidoreductase complex subunit D Shigella sonnei (strain Ss046)
B6IB68 1.22e-21 98 28 9 305 3 rsxD Ion-translocating oxidoreductase complex subunit D Escherichia coli (strain SE11)
B7M0I7 1.22e-21 98 28 9 305 3 rsxD Ion-translocating oxidoreductase complex subunit D Escherichia coli O8 (strain IAI1)
B7L5I3 1.22e-21 98 28 9 305 3 rsxD Ion-translocating oxidoreductase complex subunit D Escherichia coli (strain 55989 / EAEC)
A6V1T6 1.31e-21 98 30 6 266 3 rnfD Ion-translocating oxidoreductase complex subunit D Pseudomonas aeruginosa (strain PA7)
B1LEQ6 1.52e-21 98 28 9 305 3 rsxD Ion-translocating oxidoreductase complex subunit D Escherichia coli (strain SMS-3-5 / SECEC)
A9MRW9 2.63e-21 97 28 11 307 3 rsxD Ion-translocating oxidoreductase complex subunit D Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q8FH94 3.19e-21 97 27 9 305 3 rsxD Ion-translocating oxidoreductase complex subunit D Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B1IQC4 3.87e-21 97 27 9 305 3 rsxD Ion-translocating oxidoreductase complex subunit D Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q15RL2 3.93e-21 97 28 10 291 3 rnfD Ion-translocating oxidoreductase complex subunit D Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
B5BKB3 1.86e-20 95 28 7 294 3 rsxD Ion-translocating oxidoreductase complex subunit D Salmonella paratyphi A (strain AKU_12601)
Q5PIC8 1.86e-20 95 28 7 294 3 rsxD Ion-translocating oxidoreductase complex subunit D Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B7VLT5 2.35e-20 94 28 7 277 3 rnfD Ion-translocating oxidoreductase complex subunit D Vibrio atlanticus (strain LGP32)
B8F7B3 2.63e-20 94 29 10 293 3 rnfD Ion-translocating oxidoreductase complex subunit D Glaesserella parasuis serovar 5 (strain SH0165)
B4T593 3.35e-20 94 28 8 294 3 rsxD Ion-translocating oxidoreductase complex subunit D Salmonella newport (strain SL254)
B5F6J1 3.35e-20 94 28 8 294 3 rsxD Ion-translocating oxidoreductase complex subunit D Salmonella agona (strain SL483)
A9N026 3.51e-20 94 28 8 294 3 rsxD Ion-translocating oxidoreductase complex subunit D Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q8ZPM3 3.72e-20 94 28 8 294 3 rsxD Ion-translocating oxidoreductase complex subunit D Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TV16 3.72e-20 94 28 8 294 3 rsxD Ion-translocating oxidoreductase complex subunit D Salmonella schwarzengrund (strain CVM19633)
B4THD3 3.72e-20 94 28 8 294 3 rsxD Ion-translocating oxidoreductase complex subunit D Salmonella heidelberg (strain SL476)
Q57PI1 3.72e-20 94 28 8 294 3 rsxD Ion-translocating oxidoreductase complex subunit D Salmonella choleraesuis (strain SC-B67)
Q8Z6Q8 3.87e-20 94 28 8 294 3 rsxD Ion-translocating oxidoreductase complex subunit D Salmonella typhi
A6VQ43 5.83e-20 94 28 7 273 3 rnfD Ion-translocating oxidoreductase complex subunit D Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
B5RAK3 7.43e-20 93 28 8 294 3 rsxD Ion-translocating oxidoreductase complex subunit D Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QV03 7.43e-20 93 28 8 294 3 rsxD Ion-translocating oxidoreductase complex subunit D Salmonella enteritidis PT4 (strain P125109)
A1S6N2 7.43e-20 93 30 12 279 3 rnfD Ion-translocating oxidoreductase complex subunit D Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
B5FIE8 1.84e-19 92 28 8 294 3 rsxD Ion-translocating oxidoreductase complex subunit D Salmonella dublin (strain CT_02021853)
B5XWP8 2.94e-19 91 28 7 275 3 rnfD Ion-translocating oxidoreductase complex subunit D Klebsiella pneumoniae (strain 342)
B3PB33 4.91e-19 91 26 7 294 3 rnfD Ion-translocating oxidoreductase complex subunit D Cellvibrio japonicus (strain Ueda107)
A8H539 7.48e-19 90 26 6 278 3 rnfD Ion-translocating oxidoreductase complex subunit D Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B6EGH4 1.09e-18 90 29 9 271 3 rnfD Ion-translocating oxidoreductase complex subunit D Aliivibrio salmonicida (strain LFI1238)
Q9CNP3 1.18e-18 90 29 9 271 3 rnfD Ion-translocating oxidoreductase complex subunit D Pasteurella multocida (strain Pm70)
C4LEP4 1.33e-18 89 26 8 272 3 rnfD Ion-translocating oxidoreductase complex subunit D Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
B8CM55 1.68e-18 89 26 7 281 3 rnfD Ion-translocating oxidoreductase complex subunit D Shewanella piezotolerans (strain WP3 / JCM 13877)
Q2SKU7 3.78e-18 88 29 9 274 3 rnfD Ion-translocating oxidoreductase complex subunit D Hahella chejuensis (strain KCTC 2396)
Q52715 5.08e-18 88 30 7 250 1 rnfD Ion-translocating oxidoreductase complex subunit D Rhodobacter capsulatus
Q4QJQ5 7.49e-18 87 27 9 278 3 rnfD Ion-translocating oxidoreductase complex subunit D Haemophilus influenzae (strain 86-028NP)
A5UBI9 1.32e-17 87 28 10 278 3 rnfD Ion-translocating oxidoreductase complex subunit D Haemophilus influenzae (strain PittEE)
A5UFC3 2.91e-17 85 28 10 278 3 rnfD Ion-translocating oxidoreductase complex subunit D Haemophilus influenzae (strain PittGG)
B0BS74 3.19e-17 85 26 5 270 3 rnfD Ion-translocating oxidoreductase complex subunit D Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
Q57288 3.48e-17 85 27 9 275 3 rnfD Ion-translocating oxidoreductase complex subunit D Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A3MYP1 3.85e-17 85 26 5 270 3 rnfD Ion-translocating oxidoreductase complex subunit D Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q2NSZ8 4.96e-17 85 27 6 255 3 rnfD Ion-translocating oxidoreductase complex subunit D Sodalis glossinidius (strain morsitans)
Q482U6 6.53e-17 85 26 6 279 3 rnfD Ion-translocating oxidoreductase complex subunit D Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
B3H011 2.62e-16 83 26 5 270 3 rnfD Ion-translocating oxidoreductase complex subunit D Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
Q8TSY3 2.11e-15 79 26 5 264 1 rnfD Ion-translocating oxidoreductase complex subunit D Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
A1WTR8 2.55e-15 80 26 6 278 3 rnfD Ion-translocating oxidoreductase complex subunit D Halorhodospira halophila (strain DSM 244 / SL1)
Q89AW7 1e-14 78 23 8 271 3 rnfD Ion-translocating oxidoreductase complex subunit D Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q65U34 1.08e-13 75 27 9 272 3 rnfD Ion-translocating oxidoreductase complex subunit D Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_15135
Feature type CDS
Gene nqrB
Product NADH:ubiquinone reductase (Na(+)-transporting) subunit B
Location 38066 - 39304 (strand: 1)
Length 1239 (nucleotides) / 412 (amino acids)
In genomic island -

Contig

Accession contig_20
Length 84833 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2054
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF03116 NQR2, RnfD, RnfE family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1805 Energy production and conversion (C) C Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrB

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K00347 Na+-transporting NADH:ubiquinone oxidoreductase subunit B [EC:7.2.1.1] - -

Protein Sequence

MGLKKFLEKIEPHFEPGGKLQRWYALYEAAATIFYTPGTVTRGRSHVRDSIDLKRLMILVWLSVFPAMFWGMYNVGNQAMPVLLDMYSGAELQQVIAGDWHYRLAELIGVSFTQDAGWVSKMLFGAVYFLPIYGVIFIVGGFWEVLFAMIRGHEINEGFFITSILLALIVPPTLPLWQAALAVTFGVVVAKEIFGGTGRNFLNPALAGRAFLFFAYPAQISGDTVWTAADGFSGATPLSQWAVGGEHQLVNTMTNQPISWMDAFIGNVPGSIGEVSTLMILIGGAVILFARIASLRIVAGVMVGMIAMSAVFNMIGSDTNPLFAMPWYWHLVLGGFAFGMIFMATDPVSASFTDKGKWAYGILIGVMCVLIRVANPAYPEGMMLAILFANLFAPLFDYLVVQANIKRRKARG

Flanking regions ( +/- flanking 50bp)

GGCCCGGTGCTGCGTGACGTACTGACCAGGATTGAGCAGGAAGGATAATCATGGGTCTGAAAAAATTTCTCGAAAAAATTGAGCCGCATTTTGAACCGGGCGGCAAATTACAGAGATGGTATGCACTGTACGAAGCAGCCGCCACCATCTTCTATACCCCGGGGACAGTTACCCGCGGGCGTTCACATGTCCGTGACTCCATCGACCTTAAACGTCTGATGATCCTGGTCTGGTTATCCGTTTTCCCTGCGATGTTCTGGGGGATGTATAACGTCGGTAACCAGGCAATGCCGGTACTGCTGGATATGTACAGCGGTGCGGAGCTTCAGCAGGTGATTGCCGGTGACTGGCATTATCGTCTGGCGGAGCTTATCGGGGTGTCCTTCACACAGGATGCGGGCTGGGTCAGCAAAATGCTGTTCGGCGCTGTCTATTTCCTGCCGATCTACGGGGTGATTTTTATCGTCGGCGGCTTCTGGGAAGTCCTGTTTGCGATGATCCGCGGGCATGAAATCAACGAAGGTTTCTTTATCACCTCCATTCTGCTGGCACTGATTGTTCCGCCGACGCTGCCGTTATGGCAGGCCGCGCTGGCTGTCACCTTCGGTGTGGTGGTCGCGAAGGAAATTTTCGGTGGTACAGGACGCAACTTCCTGAACCCGGCACTGGCCGGCCGTGCTTTCCTGTTCTTCGCTTATCCGGCTCAGATTTCCGGTGACACTGTCTGGACTGCCGCTGACGGCTTTTCCGGTGCAACCCCGCTGTCACAGTGGGCGGTCGGTGGCGAGCATCAGCTCGTTAATACCATGACCAACCAGCCGATTTCCTGGATGGATGCCTTTATCGGTAACGTACCGGGCTCGATTGGTGAAGTTTCCACGCTGATGATTCTGATCGGTGGTGCAGTCATTCTGTTTGCCCGTATTGCGTCTTTGCGTATTGTGGCCGGTGTGATGGTCGGGATGATCGCAATGTCCGCCGTCTTTAATATGATTGGTTCGGATACCAACCCGCTGTTTGCTATGCCGTGGTACTGGCATCTGGTCCTGGGCGGTTTTGCCTTCGGTATGATTTTCATGGCGACGGACCCGGTTTCAGCCTCATTTACCGACAAAGGGAAATGGGCTTACGGGATCCTGATCGGGGTGATGTGTGTCCTGATCCGTGTGGCAAACCCGGCATATCCGGAAGGGATGATGCTGGCTATCCTGTTCGCCAACTTATTCGCCCCGTTATTTGATTATCTGGTGGTTCAGGCAAACATTAAACGGAGAAAAGCACGTGGCTAATGAAAAAACGAAAAACAAGGACAGTGTCGCAAGAACGTTTATCGTTGTCT