Homologs in group_3440

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_07765 EHELCC_07765 100.0 Morganella morganii S2 - hypothetical protein
NLDBIP_08090 NLDBIP_08090 100.0 Morganella morganii S4 - hypothetical protein
LHKJJB_06175 LHKJJB_06175 100.0 Morganella morganii S3 - hypothetical protein
HKOGLL_04740 HKOGLL_04740 100.0 Morganella morganii S5 - hypothetical protein

Distribution of the homologs in the orthogroup group_3440

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3440

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P55620 0.000158 42 44 0 43 3 NGR_a01970 Probable transposase for insertion sequence element ISRM3-like Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P80011 0.000775 39 44 0 43 3 R00164 Transposase for insertion sequence element ISRM3 Rhizobium meliloti (strain 1021)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_14515
Feature type CDS
Gene -
Product hypothetical protein
Location 98852 - 99121 (strand: -1)
Length 270 (nucleotides) / 89 (amino acids)
In genomic island GI37

Contig

Accession contig_18
Length 100673 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3440
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Domains

PF00872 Transposase, Mutator family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3328 Mobilome: prophages, transposons (X) X Transposase (or an inactivated derivative)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07493 putative transposase - -

Protein Sequence

MKKHQTTLSNEIEQKIIRLFAIGMSYADISREIEDLYAFSVSAATISAVTDEVCSGQLKLAMVLEFFRYWFSDSFGGNPPLYSCGLTSL

Flanking regions ( +/- flanking 50bp)

TTTGAGCTGGCTACTCCACGCGATCGCAACGGCTCTTTTAACCACAACTGATGAAGAAGCACCAGACCACACTATCAAACGAGATTGAGCAAAAAATTATCCGGTTATTTGCCATCGGTATGAGCTACGCCGATATTAGCCGGGAAATAGAAGATCTATATGCCTTCAGCGTCTCCGCAGCTACCATCAGCGCTGTCACTGACGAGGTTTGTAGTGGTCAACTAAAACTGGCCATGGTTTTAGAGTTTTTTCGGTATTGGTTTTCTGATTCGTTTGGTGGTAATCCACCGTTATATTCATGCGGTCTGACTTCGCTGTAATACCCGACGATATAATCCATTATTGCATGGACTGCTTCATTGAAGTTGGT