Homologs in group_3431

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_07840 EHELCC_07840 100.0 Morganella morganii S2 - Transcriptional regulator
NLDBIP_08165 NLDBIP_08165 100.0 Morganella morganii S4 - Transcriptional regulator
LHKJJB_06100 LHKJJB_06100 100.0 Morganella morganii S3 - Transcriptional regulator
HKOGLL_04815 HKOGLL_04815 100.0 Morganella morganii S5 - Transcriptional regulator

Distribution of the homologs in the orthogroup group_3431

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3431

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P06903 2.97e-21 81 58 0 63 2 ner Negative regulator of transcription Escherichia phage D108
P0ACH4 5.52e-17 71 55 0 63 3 sfsB Sugar fermentation stimulation protein B Shigella flexneri
P0ACH1 5.52e-17 71 55 0 63 3 sfsB Sugar fermentation stimulation protein B Escherichia coli (strain K12)
P0ACH2 5.52e-17 71 55 0 63 3 sfsB Sugar fermentation stimulation protein B Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ACH3 5.52e-17 71 55 0 63 3 sfsB Sugar fermentation stimulation protein B Escherichia coli O157:H7
P46496 2.78e-16 69 47 0 65 3 nlp Mu-like prophage FluMu DNA-binding protein Ner Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P06020 6.99e-16 67 51 0 66 1 ner Negative regulator of transcription Escherichia phage Mu

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_14440
Feature type CDS
Gene -
Product Transcriptional regulator
Location 86672 - 86887 (strand: -1)
Length 216 (nucleotides) / 71 (amino acids)

Contig

Accession contig_18
Length 100673 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3431
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Domains

PF13693 Winged helix-turn-helix DNA-binding

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3423 Transcription (K) K Predicted transcriptional regulator, lambda repressor-like DNA-binding domain

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07724 Ner family transcriptional regulator - -

Protein Sequence

MKETDWHRADIVAALHKQGLSLSQLSLAAGLSASTLRNALRAPYPRAERIIAQAIGIPASEIWPSRYPKLK

Flanking regions ( +/- flanking 50bp)

ACGGTGTAACCGCAAGATTCTCACAATTTTATACAAAGGAAAAGTCATCTATGAAAGAAACAGACTGGCACAGGGCTGATATCGTAGCGGCTCTGCACAAACAAGGGCTTTCATTGTCTCAGTTATCACTTGCGGCAGGTCTGTCTGCATCGACTCTGCGAAATGCGTTGAGGGCCCCTTATCCTCGTGCTGAGAGGATTATTGCACAGGCAATTGGTATACCTGCCAGTGAAATATGGCCTTCCCGTTACCCAAAACTGAAATAGTTACCGGCAGGATTTATATAGATATGAAAAAAATAATCATAACAGCAGGT