Homologs in group_1954

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_08015 EHELCC_08015 100.0 Morganella morganii S2 truA tRNA pseudouridine(38-40) synthase TruA
NLDBIP_08340 NLDBIP_08340 100.0 Morganella morganii S4 truA tRNA pseudouridine(38-40) synthase TruA
LHKJJB_05925 LHKJJB_05925 100.0 Morganella morganii S3 truA tRNA pseudouridine(38-40) synthase TruA
HKOGLL_04990 HKOGLL_04990 100.0 Morganella morganii S5 truA tRNA pseudouridine(38-40) synthase TruA
F4V73_RS02645 F4V73_RS02645 74.7 Morganella psychrotolerans truA tRNA pseudouridine(38-40) synthase TruA
PMI_RS08775 PMI_RS08775 80.6 Proteus mirabilis HI4320 truA tRNA pseudouridine(38-40) synthase TruA

Distribution of the homologs in the orthogroup group_1954

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1954

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7MB17 5.65e-159 445 79 0 259 3 truA tRNA pseudouridine synthase A Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A7MH65 1.43e-156 439 75 1 273 3 truA tRNA pseudouridine synthase A Cronobacter sakazakii (strain ATCC BAA-894)
B7LLF2 1.7e-154 434 78 0 259 3 truA tRNA pseudouridine synthase A Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
P07649 1.91e-154 434 78 0 259 1 truA tRNA pseudouridine synthase A Escherichia coli (strain K12)
B1X929 1.91e-154 434 78 0 259 3 truA tRNA pseudouridine synthase A Escherichia coli (strain K12 / DH10B)
C4ZVL1 1.91e-154 434 78 0 259 3 truA tRNA pseudouridine synthase A Escherichia coli (strain K12 / MC4100 / BW2952)
Q6D2N7 3.16e-154 434 76 0 265 3 truA tRNA pseudouridine synthase A Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q8ZNB9 7.29e-154 432 77 0 259 3 truA tRNA pseudouridine synthase A Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z500 1.08e-153 432 77 0 259 3 truA tRNA pseudouridine synthase A Salmonella typhi
B4TQA4 1.08e-153 432 77 0 259 3 truA tRNA pseudouridine synthase A Salmonella schwarzengrund (strain CVM19633)
B5BCH8 1.08e-153 432 77 0 259 3 truA tRNA pseudouridine synthase A Salmonella paratyphi A (strain AKU_12601)
C0PZZ5 1.08e-153 432 77 0 259 3 truA tRNA pseudouridine synthase A Salmonella paratyphi C (strain RKS4594)
A9N476 1.08e-153 432 77 0 259 3 truA tRNA pseudouridine synthase A Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PCV6 1.08e-153 432 77 0 259 3 truA tRNA pseudouridine synthase A Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SZP0 1.08e-153 432 77 0 259 3 truA tRNA pseudouridine synthase A Salmonella newport (strain SL254)
B4TBN7 1.08e-153 432 77 0 259 3 truA tRNA pseudouridine synthase A Salmonella heidelberg (strain SL476)
B5RCJ3 1.08e-153 432 77 0 259 3 truA tRNA pseudouridine synthase A Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R349 1.08e-153 432 77 0 259 3 truA tRNA pseudouridine synthase A Salmonella enteritidis PT4 (strain P125109)
B5FPL2 1.08e-153 432 77 0 259 3 truA tRNA pseudouridine synthase A Salmonella dublin (strain CT_02021853)
Q57LY6 1.08e-153 432 77 0 259 3 truA tRNA pseudouridine synthase A Salmonella choleraesuis (strain SC-B67)
B5EZQ2 1.08e-153 432 77 0 259 3 truA tRNA pseudouridine synthase A Salmonella agona (strain SL483)
B1IXM4 1.41e-153 432 77 0 259 3 truA tRNA pseudouridine synthase A Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A2I7 1.41e-153 432 77 0 259 3 truA tRNA pseudouridine synthase A Escherichia coli O9:H4 (strain HS)
Q1R994 1.62e-153 431 78 0 259 3 truA tRNA pseudouridine synthase A Escherichia coli (strain UTI89 / UPEC)
Q0TFC8 1.62e-153 431 78 0 259 3 truA tRNA pseudouridine synthase A Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1ADG7 1.62e-153 431 78 0 259 3 truA tRNA pseudouridine synthase A Escherichia coli O1:K1 / APEC
B7MXZ5 1.62e-153 431 78 0 259 3 truA tRNA pseudouridine synthase A Escherichia coli O81 (strain ED1a)
B7MG82 1.62e-153 431 78 0 259 3 truA tRNA pseudouridine synthase A Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UFX6 1.62e-153 431 78 0 259 3 truA tRNA pseudouridine synthase A Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZPD3 1.62e-153 431 78 0 259 3 truA tRNA pseudouridine synthase A Escherichia coli O139:H28 (strain E24377A / ETEC)
Q31YE0 2.36e-153 431 77 0 259 3 truA tRNA pseudouridine synthase A Shigella boydii serotype 4 (strain Sb227)
Q83QR3 2.6e-153 431 77 0 259 3 truA tRNA pseudouridine synthase A Shigella flexneri
Q0T2G7 2.6e-153 431 77 0 259 3 truA tRNA pseudouridine synthase A Shigella flexneri serotype 5b (strain 8401)
B2TWA0 2.6e-153 431 77 0 259 3 truA tRNA pseudouridine synthase A Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B6I4U6 2.6e-153 431 77 0 259 3 truA tRNA pseudouridine synthase A Escherichia coli (strain SE11)
B7M6J9 2.6e-153 431 77 0 259 3 truA tRNA pseudouridine synthase A Escherichia coli O8 (strain IAI1)
Q32DL8 4.85e-153 430 77 0 259 3 truA tRNA pseudouridine synthase A Shigella dysenteriae serotype 1 (strain Sd197)
B1LLS3 4.85e-153 430 77 0 259 3 truA tRNA pseudouridine synthase A Escherichia coli (strain SMS-3-5 / SECEC)
B7N5T0 4.85e-153 430 77 0 259 3 truA tRNA pseudouridine synthase A Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P65844 4.85e-153 430 77 0 259 3 truA tRNA pseudouridine synthase A Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B7NNZ9 4.85e-153 430 77 0 259 3 truA tRNA pseudouridine synthase A Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YXV8 4.85e-153 430 77 0 259 3 truA tRNA pseudouridine synthase A Escherichia coli O157:H7 (strain EC4115 / EHEC)
P65845 4.85e-153 430 77 0 259 3 truA tRNA pseudouridine synthase A Escherichia coli O157:H7
B7LBH2 4.85e-153 430 77 0 259 3 truA tRNA pseudouridine synthase A Escherichia coli (strain 55989 / EAEC)
Q3YZP3 1.71e-152 429 77 0 259 3 truA tRNA pseudouridine synthase A Shigella sonnei (strain Ss046)
A6TC04 3.73e-152 428 78 0 259 3 truA tRNA pseudouridine synthase A Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XNR9 1.07e-151 427 78 0 259 3 truA tRNA pseudouridine synthase A Klebsiella pneumoniae (strain 342)
A9MJ57 1.13e-150 424 76 0 259 3 truA tRNA pseudouridine synthase A Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A4WCV2 1.27e-150 424 76 0 259 3 truA tRNA pseudouridine synthase A Enterobacter sp. (strain 638)
A8ADR1 1.55e-150 424 77 0 259 3 truA tRNA pseudouridine synthase A Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q668W9 3e-150 423 78 0 259 3 truA tRNA pseudouridine synthase A Yersinia pseudotuberculosis serotype I (strain IP32953)
Q8ZD27 3e-150 423 78 0 259 3 truA tRNA pseudouridine synthase A Yersinia pestis
A7FGM1 3e-150 423 78 0 259 3 truA tRNA pseudouridine synthase A Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q0HKB3 4.97e-139 394 70 0 259 3 truA tRNA pseudouridine synthase A Shewanella sp. (strain MR-4)
A0KV94 5.8e-139 394 70 0 259 3 truA tRNA pseudouridine synthase A Shewanella sp. (strain ANA-3)
Q0HWL5 7.22e-139 394 70 0 259 3 truA tRNA pseudouridine synthase A Shewanella sp. (strain MR-7)
A6WQ04 1.61e-138 393 70 0 259 3 truA tRNA pseudouridine synthase A Shewanella baltica (strain OS185)
A1RIB0 5.24e-138 392 70 0 259 3 truA tRNA pseudouridine synthase A Shewanella sp. (strain W3-18-1)
A4Y879 1.55e-137 390 70 0 259 3 truA tRNA pseudouridine synthase A Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A3D666 1.58e-137 390 70 0 259 3 truA tRNA pseudouridine synthase A Shewanella baltica (strain OS155 / ATCC BAA-1091)
A9KTU7 1.77e-137 390 70 0 259 3 truA tRNA pseudouridine synthase A Shewanella baltica (strain OS195)
B8EEB7 2.86e-137 390 70 0 259 3 truA tRNA pseudouridine synthase A Shewanella baltica (strain OS223)
A3QFC4 6.56e-136 387 71 0 259 3 truA tRNA pseudouridine synthase A Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q12P55 4.07e-134 382 67 0 259 3 truA tRNA pseudouridine synthase A Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
B8CPW5 7.36e-134 381 68 0 259 3 truA tRNA pseudouridine synthase A Shewanella piezotolerans (strain WP3 / JCM 13877)
A1S7J9 1.52e-133 380 68 0 259 3 truA tRNA pseudouridine synthase A Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
C3LTP7 2.91e-133 380 70 0 259 3 truA tRNA pseudouridine synthase A Vibrio cholerae serotype O1 (strain M66-2)
Q9KTA4 2.91e-133 380 70 0 259 3 truA tRNA pseudouridine synthase A Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F2T4 2.91e-133 380 70 0 259 3 truA tRNA pseudouridine synthase A Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
A4SNT8 5.38e-133 379 69 0 259 3 truA tRNA pseudouridine synthase A Aeromonas salmonicida (strain A449)
Q7M7J4 2.09e-132 378 70 0 259 3 truA tRNA pseudouridine synthase A Vibrio vulnificus (strain YJ016)
Q8CWK3 2.09e-132 378 70 0 259 3 truA tRNA pseudouridine synthase A Vibrio vulnificus (strain CMCP6)
B0TKZ4 1.29e-131 376 67 0 259 3 truA tRNA pseudouridine synthase A Shewanella halifaxensis (strain HAW-EB4)
Q87MP1 1.5e-131 375 70 0 259 3 truA tRNA pseudouridine synthase A Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B0BPI7 1.7e-131 375 67 0 259 3 truA tRNA pseudouridine synthase A Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3GXP8 1.76e-131 375 67 0 259 3 truA tRNA pseudouridine synthase A Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
B7VL84 7.18e-131 374 68 0 259 3 truA tRNA pseudouridine synthase A Vibrio atlanticus (strain LGP32)
B1KKN8 3.37e-130 372 67 0 259 3 truA tRNA pseudouridine synthase A Shewanella woodyi (strain ATCC 51908 / MS32)
A7MS76 4.62e-130 372 69 0 259 3 truA tRNA pseudouridine synthase A Vibrio campbellii (strain ATCC BAA-1116)
A0KLN7 4.93e-130 372 67 0 259 3 truA tRNA pseudouridine synthase A Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A3N0R2 6.52e-130 371 67 0 259 3 truA tRNA pseudouridine synthase A Actinobacillus pleuropneumoniae serotype 5b (strain L20)
A8H305 9.98e-130 371 66 0 259 3 truA tRNA pseudouridine synthase A Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
Q7U335 1.43e-128 368 66 0 259 3 truA tRNA pseudouridine synthase A Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q65TC8 4.78e-128 367 67 0 259 3 truA tRNA pseudouridine synthase A Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
A8FTU0 4.02e-127 364 65 0 259 3 truA tRNA pseudouridine synthase A Shewanella sediminis (strain HAW-EB3)
B5FFN7 1.3e-126 363 67 0 257 3 truA tRNA pseudouridine synthase A Aliivibrio fischeri (strain MJ11)
Q5E455 1.3e-126 363 67 0 257 3 truA tRNA pseudouridine synthase A Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q6LNU5 1.57e-124 358 65 0 259 3 truA tRNA pseudouridine synthase A Photobacterium profundum (strain SS9)
B6EIW6 2.3e-124 357 65 0 259 3 truA tRNA pseudouridine synthase A Aliivibrio salmonicida (strain LFI1238)
A1SW72 1.67e-123 355 63 0 257 3 truA tRNA pseudouridine synthase A Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
A6VQ16 2.33e-123 355 64 0 259 3 truA tRNA pseudouridine synthase A Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q084R8 1.47e-122 353 63 0 259 3 truA tRNA pseudouridine synthase A Shewanella frigidimarina (strain NCIMB 400)
Q0I4X5 2.44e-122 352 64 0 259 3 truA tRNA pseudouridine synthase A Histophilus somni (strain 129Pt)
Q15VG2 2.72e-122 352 62 0 259 3 truA tRNA pseudouridine synthase A Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q4QL79 3.08e-122 352 63 0 259 3 truA tRNA pseudouridine synthase A Haemophilus influenzae (strain 86-028NP)
P45291 4.13e-122 352 63 0 259 3 truA tRNA pseudouridine synthase A Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
B0USP1 6.99e-122 351 64 0 259 3 truA tRNA pseudouridine synthase A Histophilus somni (strain 2336)
A5UIY2 8.99e-122 351 62 0 259 3 truA tRNA pseudouridine synthase A Haemophilus influenzae (strain PittGG)
P57861 9.3e-122 351 64 0 259 3 truA tRNA pseudouridine synthase A Pasteurella multocida (strain Pm70)
B8F382 1.53e-119 345 64 0 256 3 truA tRNA pseudouridine synthase A Glaesserella parasuis serovar 5 (strain SH0165)
C4LF13 2.22e-119 345 63 0 257 3 truA tRNA pseudouridine synthase A Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q5QUE5 1.38e-114 333 61 0 259 3 truA tRNA pseudouridine synthase A Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q47XK4 1.7e-113 330 60 0 256 3 truA tRNA pseudouridine synthase A Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q3IF40 7.44e-110 321 59 0 259 3 truA tRNA pseudouridine synthase A Pseudoalteromonas translucida (strain TAC 125)
Q31HH6 1.16e-106 313 60 0 258 3 truA tRNA pseudouridine synthase A Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
B8D7A3 6.26e-104 306 55 0 258 3 truA tRNA pseudouridine synthase A Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
B8D8Z8 6.26e-104 306 55 0 258 3 truA tRNA pseudouridine synthase A Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
O87016 3.7e-103 305 55 2 278 3 truA tRNA pseudouridine synthase A Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P57295 1.87e-102 302 54 0 258 3 truA tRNA pseudouridine synthase A Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q492H3 2.64e-102 301 54 0 258 3 truA tRNA pseudouridine synthase A Blochmanniella pennsylvanica (strain BPEN)
Q5ZVY6 1.47e-99 295 54 0 257 3 truA tRNA pseudouridine synthase A Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A5IBF5 1.47e-99 295 54 0 257 3 truA tRNA pseudouridine synthase A Legionella pneumophila (strain Corby)
Q5X5Q4 1.47e-99 295 54 0 257 3 truA tRNA pseudouridine synthase A Legionella pneumophila (strain Paris)
A9ND24 1.5e-99 295 54 0 257 3 truA tRNA pseudouridine synthase A Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KFZ5 1.5e-99 295 54 0 257 3 truA tRNA pseudouridine synthase A Coxiella burnetii (strain Dugway 5J108-111)
B6J0H0 1.5e-99 295 54 0 257 3 truA tRNA pseudouridine synthase A Coxiella burnetii (strain CbuG_Q212)
B6J6W3 1.5e-99 295 54 0 257 3 truA tRNA pseudouridine synthase A Coxiella burnetii (strain CbuK_Q154)
Q5WX34 5.29e-99 293 54 0 257 3 truA tRNA pseudouridine synthase A Legionella pneumophila (strain Lens)
Q7U356 1.1e-98 292 55 0 245 3 truA tRNA pseudouridine synthase A Blochmanniella floridana
P59508 4.61e-96 286 49 0 257 3 truA tRNA pseudouridine synthase A Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q0VPI7 6.07e-94 280 52 1 262 3 truA tRNA pseudouridine synthase A Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
B0V4L0 1.91e-93 279 50 1 257 3 truA tRNA pseudouridine synthase A Acinetobacter baumannii (strain AYE)
B7I4E8 1.91e-93 279 50 1 257 3 truA tRNA pseudouridine synthase A Acinetobacter baumannii (strain AB0057)
B7H0S9 1.91e-93 279 50 1 257 3 truA tRNA pseudouridine synthase A Acinetobacter baumannii (strain AB307-0294)
B0VLA5 4.42e-93 278 50 1 257 3 truA tRNA pseudouridine synthase A Acinetobacter baumannii (strain SDF)
A3M1T4 7.63e-93 278 50 1 257 3 truA tRNA pseudouridine synthase A Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
Q8K9U4 1.19e-92 277 49 1 254 3 truA tRNA pseudouridine synthase A Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
B2I367 2.65e-92 276 50 1 257 3 truA tRNA pseudouridine synthase A Acinetobacter baumannii (strain ACICU)
Q3JCC0 1.34e-91 274 54 0 248 3 truA tRNA pseudouridine synthase A Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q6FEV2 3.15e-91 274 50 1 257 3 truA tRNA pseudouridine synthase A Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q604P1 8.79e-91 273 53 0 259 3 truA tRNA pseudouridine synthase A Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
B2T9N4 8.23e-83 252 48 0 253 3 truA tRNA pseudouridine synthase A Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q5P1J2 4.04e-82 250 51 0 249 3 truA tRNA pseudouridine synthase A Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q13S27 6.04e-82 250 48 0 253 3 truA tRNA pseudouridine synthase A Paraburkholderia xenovorans (strain LB400)
Q3SHL7 2.55e-81 248 48 0 248 3 truA tRNA pseudouridine synthase A Thiobacillus denitrificans (strain ATCC 25259)
A4JMC2 2.29e-80 246 46 0 253 3 truA tRNA pseudouridine synthase A Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q2KYM0 3.55e-80 245 46 1 262 3 truA tRNA pseudouridine synthase A Bordetella avium (strain 197N)
Q7NUD6 9.69e-80 244 50 1 250 3 truA tRNA pseudouridine synthase A Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
A9M0B8 1.63e-79 244 48 1 256 3 truA tRNA pseudouridine synthase A Neisseria meningitidis serogroup C (strain 053442)
B2SGK2 2.64e-79 243 48 0 241 3 truA tRNA pseudouridine synthase A Francisella tularensis subsp. mediasiatica (strain FSC147)
A4IXW8 2.76e-79 243 48 0 241 3 truA tRNA pseudouridine synthase A Francisella tularensis subsp. tularensis (strain WY96-3418)
B2JQE6 2.81e-79 243 45 0 255 3 truA tRNA pseudouridine synthase A Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q0BLV1 2.82e-79 243 48 0 241 3 truA tRNA pseudouridine synthase A Francisella tularensis subsp. holarctica (strain OSU18)
Q2A3D7 2.82e-79 243 48 0 241 3 truA tRNA pseudouridine synthase A Francisella tularensis subsp. holarctica (strain LVS)
Q8XXX8 2.82e-79 243 49 2 263 3 truA tRNA pseudouridine synthase A Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
A7NCA0 3.43e-79 243 48 0 241 3 truA tRNA pseudouridine synthase A Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
B0U6K4 4.76e-79 242 52 1 248 3 truA tRNA pseudouridine synthase A Xylella fastidiosa (strain M12)
Q5NG36 6.04e-79 242 48 0 241 3 truA tRNA pseudouridine synthase A Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q14HI8 6.04e-79 242 48 0 241 3 truA tRNA pseudouridine synthase A Francisella tularensis subsp. tularensis (strain FSC 198)
A9IRL0 7.31e-79 242 47 1 249 3 truA tRNA pseudouridine synthase A Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Q47HQ7 1.17e-78 241 48 0 250 3 truA tRNA pseudouridine synthase A Dechloromonas aromatica (strain RCB)
A0Q6C2 1.19e-78 241 48 0 241 3 truA tRNA pseudouridine synthase A Francisella tularensis subsp. novicida (strain U112)
Q9JXI2 1.49e-78 241 48 1 256 3 truA tRNA pseudouridine synthase A Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q87DS1 2.46e-78 240 52 1 248 3 truA tRNA pseudouridine synthase A Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I9J0 2.46e-78 240 52 1 248 3 truA tRNA pseudouridine synthase A Xylella fastidiosa (strain M23)
Q9JWF1 4.23e-78 240 48 1 256 3 truA tRNA pseudouridine synthase A Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q8D2P5 9.77e-78 239 43 0 248 3 truA tRNA pseudouridine synthase A Wigglesworthia glossinidia brevipalpis
Q8P7R5 1.48e-77 238 51 1 250 3 truA tRNA pseudouridine synthase A Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RR81 1.48e-77 238 51 1 250 3 truA tRNA pseudouridine synthase A Xanthomonas campestris pv. campestris (strain B100)
Q4UWD5 1.48e-77 238 51 1 250 3 truA tRNA pseudouridine synthase A Xanthomonas campestris pv. campestris (strain 8004)
B4SQV6 1.79e-77 238 52 1 249 3 truA tRNA pseudouridine synthase A Stenotrophomonas maltophilia (strain R551-3)
A1KWB6 1.96e-77 238 48 1 256 3 truA tRNA pseudouridine synthase A Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
B2FNZ6 2.48e-77 238 52 1 249 3 truA tRNA pseudouridine synthase A Stenotrophomonas maltophilia (strain K279a)
Q9PDK6 4.92e-77 237 52 1 248 3 truA tRNA pseudouridine synthase A Xylella fastidiosa (strain 9a5c)
A3NM70 5.55e-77 237 45 0 253 3 truA tRNA pseudouridine synthase A Burkholderia pseudomallei (strain 668)
Q3JKH3 5.55e-77 237 45 0 253 3 truA tRNA pseudouridine synthase A Burkholderia pseudomallei (strain 1710b)
A3P7N2 5.55e-77 237 45 0 253 3 truA tRNA pseudouridine synthase A Burkholderia pseudomallei (strain 1106a)
A1UZ38 5.55e-77 237 45 0 253 3 truA tRNA pseudouridine synthase A Burkholderia mallei (strain SAVP1)
Q62AJ2 5.55e-77 237 45 0 253 3 truA tRNA pseudouridine synthase A Burkholderia mallei (strain ATCC 23344)
Q7U376 6.12e-77 237 45 1 262 3 truA tRNA pseudouridine synthase A Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7U386 6.12e-77 237 45 1 262 3 truA tRNA pseudouridine synthase A Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q63JL6 6.25e-77 237 45 0 253 3 truA tRNA pseudouridine synthase A Burkholderia pseudomallei (strain K96243)
A2S134 6.25e-77 237 45 0 253 3 truA tRNA pseudouridine synthase A Burkholderia mallei (strain NCTC 10229)
A3MBU2 6.25e-77 237 45 0 253 3 truA tRNA pseudouridine synthase A Burkholderia mallei (strain NCTC 10247)
Q0BAC2 8.57e-77 237 47 0 253 3 truA tRNA pseudouridine synthase A Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q2T7H3 1.08e-76 237 45 0 253 3 truA tRNA pseudouridine synthase A Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q5F5V8 1.15e-76 236 48 1 256 3 truA tRNA pseudouridine synthase A Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
B1Z1N7 1.21e-76 236 47 0 253 3 truA tRNA pseudouridine synthase A Burkholderia ambifaria (strain MC40-6)
Q1H0L9 1.83e-76 236 48 0 249 3 truA tRNA pseudouridine synthase A Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q5GXR2 2.54e-76 235 52 1 250 3 truA tRNA pseudouridine synthase A Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SVP0 2.54e-76 235 52 1 250 3 truA tRNA pseudouridine synthase A Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2P0T9 2.54e-76 235 52 1 250 3 truA tRNA pseudouridine synthase A Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q83WJ5 3.03e-76 236 47 0 253 3 truA tRNA pseudouridine synthase A Burkholderia multivorans (strain ATCC 17616 / 249)
Q8PJ25 4.83e-76 234 52 1 250 3 truA tRNA pseudouridine synthase A Xanthomonas axonopodis pv. citri (strain 306)
A4SWX4 1.54e-75 234 45 2 261 3 truA tRNA pseudouridine synthase A Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
A6T009 1.6e-75 234 46 1 254 3 truA tRNA pseudouridine synthase A Janthinobacterium sp. (strain Marseille)
B0U0B1 2.03e-75 233 46 0 241 3 truA tRNA pseudouridine synthase A Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
B2U6Z1 6.4e-75 232 47 1 251 3 truA tRNA pseudouridine synthase A Ralstonia pickettii (strain 12J)
Q0AGX7 8.01e-75 232 46 0 249 3 truA tRNA pseudouridine synthase A Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
A1VRR5 1.67e-74 231 47 1 253 3 truA tRNA pseudouridine synthase A Polaromonas naphthalenivorans (strain CJ2)
Q393X8 5.59e-74 230 47 0 253 3 truA tRNA pseudouridine synthase A Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
B4RR02 5.75e-74 229 46 1 256 3 truA tRNA pseudouridine synthase A Neisseria gonorrhoeae (strain NCCP11945)
Q7U363 3.25e-73 228 47 1 251 3 truA tRNA pseudouridine synthase A Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q1BM62 3.33e-73 228 46 0 253 3 truA tRNA pseudouridine synthase A Burkholderia orbicola (strain AU 1054)
B1K370 3.33e-73 228 46 0 253 3 truA tRNA pseudouridine synthase A Burkholderia orbicola (strain MC0-3)
A0AZ67 3.33e-73 228 46 0 253 3 truA tRNA pseudouridine synthase A Burkholderia cenocepacia (strain HI2424)
A4G4G0 3.61e-72 225 45 1 252 3 truA tRNA pseudouridine synthase A Herminiimonas arsenicoxydans
A2SHS6 1.45e-71 223 46 0 248 3 truA tRNA pseudouridine synthase A Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
Q3BRL0 1.52e-71 223 52 1 250 3 truA tRNA pseudouridine synthase A Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q820P8 8.18e-71 222 44 1 261 3 truA tRNA pseudouridine synthase A Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q126M3 1.1e-70 221 44 1 253 3 truA tRNA pseudouridine synthase A Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q21XI4 2.94e-70 220 45 0 248 3 truA tRNA pseudouridine synthase A Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
B1XV49 5.09e-70 220 41 2 267 3 truA tRNA pseudouridine synthase A Polynucleobacter necessarius subsp. necessarius (strain STIR1)
A1TLH0 1.91e-69 218 43 1 267 3 truA tRNA pseudouridine synthase A Paracidovorax citrulli (strain AAC00-1)
C5CSH0 6.39e-69 217 44 1 255 3 truA tRNA pseudouridine synthase A Variovorax paradoxus (strain S110)
A1WAT5 1.98e-67 213 41 1 263 3 truA tRNA pseudouridine synthase A Acidovorax sp. (strain JS42)
Q46YW3 2.51e-67 213 42 1 253 3 truA tRNA pseudouridine synthase A Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
A1WSF3 9.88e-67 211 44 1 260 3 truA tRNA pseudouridine synthase A Verminephrobacter eiseniae (strain EF01-2)
B9MDL6 1.22e-66 211 41 1 263 3 truA tRNA pseudouridine synthase A Acidovorax ebreus (strain TPSY)
Q0K8H3 3.29e-66 210 43 1 253 3 truA tRNA pseudouridine synthase A Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q5FPX3 3.94e-66 210 45 4 253 3 truA tRNA pseudouridine synthase A Gluconobacter oxydans (strain 621H)
A9BNH5 6.17e-66 209 41 1 271 3 truA tRNA pseudouridine synthase A Delftia acidovorans (strain DSM 14801 / SPH-1)
B3R117 5.64e-65 207 43 1 253 3 truA tRNA pseudouridine synthase A Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q6G547 2.11e-64 204 42 1 242 3 truA tRNA pseudouridine synthase A Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
B0UP40 5.51e-64 204 45 1 242 3 truA tRNA pseudouridine synthase A Methylobacterium sp. (strain 4-46)
A4XKB7 1.14e-62 200 40 0 242 3 truA tRNA pseudouridine synthase A Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
A1UUB6 3.89e-62 199 41 3 247 3 truA tRNA pseudouridine synthase A Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
A9ILJ7 5.66e-61 196 40 1 242 3 truA tRNA pseudouridine synthase A Bartonella tribocorum (strain CIP 105476 / IBS 506)
B1M6N9 6.94e-61 196 43 2 244 3 truA tRNA pseudouridine synthase A Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
B0K5S6 1.19e-60 195 38 0 242 3 truA tRNA pseudouridine synthase A Thermoanaerobacter sp. (strain X514)
B0KCN3 1.19e-60 195 38 0 242 3 truA tRNA pseudouridine synthase A Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
Q6G1G9 1.42e-60 195 41 3 248 3 truA tRNA pseudouridine synthase A Bartonella quintana (strain Toulouse)
Q0ASJ7 2.99e-60 194 43 3 242 3 truA tRNA pseudouridine synthase A Maricaulis maris (strain MCS10)
A3DJK8 5.73e-60 193 38 0 242 3 truA tRNA pseudouridine synthase A Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
A8F079 6.65e-60 193 42 1 240 3 truA tRNA pseudouridine synthase A Rickettsia canadensis (strain McKiel)
Q3A3B5 1.19e-59 192 42 0 243 3 truA tRNA pseudouridine synthase A Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
B1ZGA6 5.02e-59 191 42 2 247 3 truA tRNA pseudouridine synthase A Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
A5FVK4 7.93e-59 191 44 2 243 3 truA tRNA pseudouridine synthase A Acidiphilium cryptum (strain JF-5)
B8I814 8.21e-59 190 41 1 242 3 truA tRNA pseudouridine synthase A Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
Q8R7Y7 2.79e-58 189 39 0 239 3 truA tRNA pseudouridine synthase A Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q60CV4 3.2e-58 189 43 4 251 3 truA tRNA pseudouridine synthase A Brucella suis biovar 1 (strain 1330)
A9WW43 3.2e-58 189 43 4 251 3 truA tRNA pseudouridine synthase A Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VVT9 3.2e-58 189 43 4 251 3 truA tRNA pseudouridine synthase A Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q8YDB2 3.2e-58 189 43 4 251 3 truA tRNA pseudouridine synthase A Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RMH2 3.2e-58 189 43 4 251 3 truA tRNA pseudouridine synthase A Brucella melitensis biotype 2 (strain ATCC 23457)
A9MCV8 3.2e-58 189 43 4 251 3 truA tRNA pseudouridine synthase A Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q576T1 3.2e-58 189 43 4 251 3 truA tRNA pseudouridine synthase A Brucella abortus biovar 1 (strain 9-941)
Q2YJQ4 3.2e-58 189 43 4 251 3 truA tRNA pseudouridine synthase A Brucella abortus (strain 2308)
B7KVW3 3.86e-58 189 41 2 244 3 truA tRNA pseudouridine synthase A Methylorubrum extorquens (strain CM4 / NCIMB 13688)
A8GU17 4.17e-58 188 42 1 240 3 truA tRNA pseudouridine synthase A Rickettsia rickettsii (strain Sheila Smith)
B0BVL0 4.17e-58 188 42 1 240 3 truA tRNA pseudouridine synthase A Rickettsia rickettsii (strain Iowa)
Q2WAT0 4.57e-58 189 44 3 245 3 truA tRNA pseudouridine synthase A Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q68VQ6 4.9e-58 188 41 1 240 3 truA tRNA pseudouridine synthase A Rickettsia typhi (strain ATCC VR-144 / Wilmington)
A9W377 7e-58 188 42 3 245 3 truA tRNA pseudouridine synthase A Methylorubrum extorquens (strain PA1)
Q2RNZ9 7.1e-58 189 44 4 255 3 truA tRNA pseudouridine synthase A Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
B9MKC1 8e-58 187 37 0 242 3 truA tRNA pseudouridine synthase A Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
A7IKI9 8.24e-58 187 44 1 240 3 truA tRNA pseudouridine synthase A Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
Q0AUL4 2.41e-57 186 39 2 252 3 truA tRNA pseudouridine synthase A Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
B8ENG8 2.42e-57 186 43 1 242 3 truA tRNA pseudouridine synthase A Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
Q92FZ9 4.27e-57 186 42 1 240 3 truA tRNA pseudouridine synthase A Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q9ZCA3 6.52e-57 185 40 1 240 3 truA tRNA pseudouridine synthase A Rickettsia prowazekii (strain Madrid E)
Q0C4U8 1.25e-56 184 43 2 241 3 truA tRNA pseudouridine synthase A Hyphomonas neptunium (strain ATCC 15444)
C3PLZ3 1.29e-56 184 42 1 240 3 truA tRNA pseudouridine synthase A Rickettsia africae (strain ESF-5)
Q98D55 1.79e-56 184 43 3 244 3 truA tRNA pseudouridine synthase A Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q5PAN6 2.13e-56 184 42 3 241 3 truA tRNA pseudouridine synthase A Anaplasma marginale (strain St. Maries)
B9KIN8 2.13e-56 184 42 3 241 3 truA tRNA pseudouridine synthase A Anaplasma marginale (strain Florida)
C4K2W2 2.55e-56 184 42 1 240 3 truA tRNA pseudouridine synthase A Rickettsia peacockii (strain Rustic)
A6WYK9 2.56e-56 184 42 4 247 3 truA tRNA pseudouridine synthase A Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
B6JJP6 2.63e-56 184 43 1 240 3 truA tRNA pseudouridine synthase A Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
Q4UJT2 3.13e-56 184 41 1 240 3 truA tRNA pseudouridine synthase A Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
A8GQ80 3.76e-56 183 42 1 240 3 truA tRNA pseudouridine synthase A Rickettsia akari (strain Hartford)
B8IFQ2 4.09e-56 184 43 2 250 3 truA tRNA pseudouridine synthase A Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
Q1RKH3 5.04e-56 183 40 1 240 3 truA tRNA pseudouridine synthase A Rickettsia bellii (strain RML369-C)
A8GUM4 5.04e-56 183 40 1 240 3 truA tRNA pseudouridine synthase A Rickettsia bellii (strain OSU 85-389)
Q1GWK1 5.97e-56 183 42 3 246 3 truA tRNA pseudouridine synthase A Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
B8GYF0 8.42e-56 182 41 3 247 3 truA tRNA pseudouridine synthase A Caulobacter vibrioides (strain NA1000 / CB15N)
Q9ABF0 8.42e-56 182 41 3 247 3 truA tRNA pseudouridine synthase A Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
B7K222 1.07e-55 184 39 5 268 3 truA tRNA pseudouridine synthase A Rippkaea orientalis (strain PCC 8801 / RF-1)
C0ZIL2 2.04e-55 181 40 0 237 3 truA tRNA pseudouridine synthase A Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
B2IEW0 2.34e-55 182 43 3 244 3 truA tRNA pseudouridine synthase A Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
Q11LD0 4.31e-55 181 42 3 243 3 truA tRNA pseudouridine synthase A Chelativorans sp. (strain BNC1)
A7HPQ3 6.17e-55 180 41 3 241 3 truA tRNA pseudouridine synthase A Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
B9M6W5 7.54e-55 180 39 0 242 3 truA tRNA pseudouridine synthase A Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
Q5FGS1 1.67e-54 179 42 4 240 3 truA tRNA pseudouridine synthase A Ehrlichia ruminantium (strain Gardel)
A5GB00 2.5e-54 179 39 0 241 3 truA tRNA pseudouridine synthase A Geotalea uraniireducens (strain Rf4)
Q3YS43 3.07e-54 178 41 4 242 3 truA tRNA pseudouridine synthase A Ehrlichia canis (strain Jake)
Q2GGK1 3.42e-54 178 40 4 242 3 truA tRNA pseudouridine synthase A Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas)
Q8XLQ0 3.46e-54 178 35 1 246 3 truA1 tRNA pseudouridine synthase A 1 Clostridium perfringens (strain 13 / Type A)
Q92SH4 3.62e-54 178 40 1 242 3 truA tRNA pseudouridine synthase A Rhizobium meliloti (strain 1021)
Q2GKK4 6.44e-54 177 40 2 240 3 truA tRNA pseudouridine synthase A Anaplasma phagocytophilum (strain HZ)
Q5HBA4 7.66e-54 177 42 4 240 3 truA tRNA pseudouridine synthase A Ehrlichia ruminantium (strain Welgevonden)
B1XJI2 9.31e-54 178 35 1 252 3 truA tRNA pseudouridine synthase A Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
B1MVY3 9.7e-54 177 39 3 249 3 truA tRNA pseudouridine synthase A Leuconostoc citreum (strain KM20)
Q7MBB9 3.3e-53 177 39 1 251 3 truA tRNA pseudouridine synthase A Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q1QH76 3.64e-53 176 42 1 240 3 truA tRNA pseudouridine synthase A Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
B3CMC1 4.15e-53 176 41 4 242 3 truA tRNA pseudouridine synthase A Wolbachia pipientis subsp. Culex pipiens (strain wPip)
B2GDT8 4.72e-53 176 40 2 240 3 truA tRNA pseudouridine synthase A Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
C6E4S9 6.7e-53 175 39 1 245 3 truA tRNA pseudouridine synthase A Geobacter sp. (strain M21)
Q93NE2 1.01e-52 175 43 3 244 3 truA tRNA pseudouridine synthase A Myxococcus xanthus
A4J151 1.21e-52 174 40 3 246 3 truA tRNA pseudouridine synthase A Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
Q3SN27 2.38e-52 174 41 1 246 3 truA tRNA pseudouridine synthase A Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
P60350 3.07e-52 173 40 0 242 3 truA tRNA pseudouridine synthase A Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
P73295 3.08e-52 174 38 3 255 3 truA tRNA pseudouridine synthase A Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q8UIC9 3.13e-52 174 40 1 244 3 truA tRNA pseudouridine synthase A Agrobacterium fabrum (strain C58 / ATCC 33970)
Q03ZL3 4.31e-52 173 38 3 247 3 truA tRNA pseudouridine synthase A Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
B5EFM8 4.94e-52 173 39 1 246 3 truA tRNA pseudouridine synthase A Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
B6IPI0 5.24e-52 173 43 1 240 3 truA tRNA pseudouridine synthase A Rhodospirillum centenum (strain ATCC 51521 / SW)
O84469 5.4e-52 173 39 3 255 3 truA tRNA pseudouridine synthase A Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
C0R4F9 5.91e-52 172 40 4 242 3 truA tRNA pseudouridine synthase A Wolbachia sp. subsp. Drosophila simulans (strain wRi)
B0T1S6 6.49e-52 172 40 1 243 3 truA tRNA pseudouridine synthase A Caulobacter sp. (strain K31)
B2G8U7 9.05e-52 172 37 2 240 3 truA tRNA pseudouridine synthase A Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A5VLH4 9.05e-52 172 37 2 240 3 truA tRNA pseudouridine synthase A Limosilactobacillus reuteri (strain DSM 20016)
A4YLC1 1.26e-51 172 42 1 240 3 truA tRNA pseudouridine synthase A Bradyrhizobium sp. (strain ORS 278)
Q9Z9J0 1.31e-51 172 39 1 235 3 truA tRNA pseudouridine synthase A Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
A5IM09 1.36e-51 172 38 3 241 3 truA tRNA pseudouridine synthase A Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
Q74L59 2.4e-51 172 38 4 256 3 truA tRNA pseudouridine synthase A Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
A5ESQ5 2.54e-51 171 42 1 240 3 truA tRNA pseudouridine synthase A Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
B3E0A0 4.2e-51 171 37 1 243 3 truA tRNA pseudouridine synthase A Methylacidiphilum infernorum (isolate V4)
Q9X1R0 4.74e-51 170 38 3 241 3 truA tRNA pseudouridine synthase A Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q63GF1 5.46e-51 170 35 1 240 3 truA2 tRNA pseudouridine synthase A 2 Bacillus cereus (strain ZK / E33L)
A6U5I6 6.04e-51 170 39 1 242 3 truA tRNA pseudouridine synthase A Sinorhizobium medicae (strain WSM419)
Q73G93 6.28e-51 170 40 4 242 3 truA tRNA pseudouridine synthase A Wolbachia pipientis wMel
Q89BP1 8.77e-51 169 41 4 243 3 truA tRNA pseudouridine synthase A Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q6I3T8 1.47e-50 169 35 1 240 3 truA2 tRNA pseudouridine synthase A 2 Bacillus anthracis
B1LB83 1.59e-50 169 38 4 243 3 truA tRNA pseudouridine synthase A Thermotoga sp. (strain RQ2)
Q893H3 1.73e-50 169 36 1 243 3 truA1 tRNA pseudouridine synthase A 1 Clostridium tetani (strain Massachusetts / E88)
Q73E17 2.17e-50 169 35 1 240 3 truA2 tRNA pseudouridine synthase A 2 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q5WLN0 2.25e-50 169 40 1 244 3 truA tRNA pseudouridine synthase A Shouchella clausii (strain KSM-K16)
A8F526 2.39e-50 168 37 1 238 3 truA tRNA pseudouridine synthase A Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO)
Q8YPK5 2.55e-50 169 35 4 257 3 truA tRNA pseudouridine synthase A Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
B0BCA1 3.13e-50 169 38 3 255 3 truA tRNA pseudouridine synthase A Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis)
B0B836 3.13e-50 169 38 3 255 3 truA tRNA pseudouridine synthase A Chlamydia trachomatis serovar L2 (strain ATCC VR-902B / DSM 19102 / 434/Bu)
B9LJG1 3.36e-50 169 42 2 250 3 truA tRNA pseudouridine synthase A Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl)
A9WH95 3.36e-50 169 42 2 250 3 truA tRNA pseudouridine synthase A Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
B9JQX0 3.69e-50 168 37 1 245 3 truA tRNA pseudouridine synthase A Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
C3MF26 4.12e-50 168 38 2 245 3 truA tRNA pseudouridine synthase A Sinorhizobium fredii (strain NBRC 101917 / NGR234)
A5N4T0 4.25e-50 168 37 0 241 3 truA tRNA pseudouridine synthase A Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
Q13F20 4.52e-50 168 42 1 240 3 truA tRNA pseudouridine synthase A Rhodopseudomonas palustris (strain BisB5)
A9BCM2 4.74e-50 169 40 3 256 3 truA tRNA pseudouridine synthase A Prochlorococcus marinus (strain MIT 9211)
B5ZN21 5.18e-50 168 38 1 244 3 truA tRNA pseudouridine synthase A Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Q3KLN5 5.92e-50 168 38 3 255 3 truA tRNA pseudouridine synthase A Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13)
Q04G54 6.22e-50 167 39 2 241 3 truA tRNA pseudouridine synthase A Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q21B58 9.41e-50 167 42 1 240 3 truA tRNA pseudouridine synthase A Rhodopseudomonas palustris (strain BisB18)
P60352 1.07e-49 167 42 1 240 3 truA tRNA pseudouridine synthase A Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q813Z9 1.19e-49 167 35 1 240 3 truA2 tRNA pseudouridine synthase A 2 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B9K8Q0 1.39e-49 166 37 4 243 3 truA tRNA pseudouridine synthase A Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E)
Q6HNW5 1.45e-49 166 35 1 240 3 truA2 tRNA pseudouridine synthase A 2 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q8CWM6 1.62e-49 167 35 3 277 3 truA tRNA pseudouridine synthase A Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q65P74 1.86e-49 166 38 1 239 3 truA tRNA pseudouridine synthase A Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
O24712 2.14e-49 167 37 1 244 3 truA tRNA pseudouridine synthase A Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
B8G6P6 3.05e-49 167 40 1 247 3 truA tRNA pseudouridine synthase A Chloroflexus aggregans (strain MD-66 / DSM 9485)
Q2RFT1 3.38e-49 166 39 1 244 3 truA tRNA pseudouridine synthase A Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
B7GJ99 4.57e-49 165 38 2 242 3 truA tRNA pseudouridine synthase A Anoxybacillus flavithermus (strain DSM 21510 / WK1)
Q9CI80 4.65e-49 166 37 3 242 3 truA tRNA pseudouridine synthase A Lactococcus lactis subsp. lactis (strain IL1403)
A2CC53 5.48e-49 166 37 2 260 3 truA tRNA pseudouridine synthase A Prochlorococcus marinus (strain MIT 9303)
A5USG0 5.96e-49 166 41 4 249 3 truA tRNA pseudouridine synthase A Roseiflexus sp. (strain RS-1)
C5CGS8 6.09e-49 165 38 4 244 3 truA tRNA pseudouridine synthase A Kosmotoga olearia (strain ATCC BAA-1733 / DSM 21960 / TBF 19.5.1)
Q2J2C4 6.48e-49 165 42 1 240 3 truA tRNA pseudouridine synthase A Rhodopseudomonas palustris (strain HaA2)
Q89ZY4 8.18e-49 165 39 4 249 3 truA tRNA pseudouridine synthase A Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q318K9 8.31e-49 165 36 2 260 3 truA tRNA pseudouridine synthase A Prochlorococcus marinus (strain MIT 9312)
A7Z0S0 8.79e-49 164 38 1 239 3 truA tRNA pseudouridine synthase A Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q5LGZ6 1.03e-48 164 39 4 248 3 truA tRNA pseudouridine synthase A Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
A8YTB0 1.27e-48 164 37 3 249 3 truA tRNA pseudouridine synthase A Lactobacillus helveticus (strain DPC 4571)
Q3J0D9 1.35e-48 164 38 4 249 3 truA tRNA pseudouridine synthase A Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q1WSC1 1.47e-48 164 37 3 251 3 truA tRNA pseudouridine synthase A Ligilactobacillus salivarius (strain UCC118)
A8IQL3 1.59e-48 164 43 1 244 3 truA tRNA pseudouridine synthase A Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q07TX2 1.68e-48 164 40 1 240 3 truA tRNA pseudouridine synthase A Rhodopseudomonas palustris (strain BisA53)
Q3AMQ5 1.77e-48 165 41 2 243 3 truA tRNA pseudouridine synthase A Synechococcus sp. (strain CC9605)
Q5M6C9 1.8e-48 164 36 3 241 3 truA tRNA pseudouridine synthase A Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5M1T6 1.8e-48 164 36 3 241 3 truA tRNA pseudouridine synthase A Streptococcus thermophilus (strain CNRZ 1066)
Q64XV0 1.93e-48 164 39 4 248 3 truA tRNA pseudouridine synthase A Bacteroides fragilis (strain YCH46)
A2BTB3 2.03e-48 164 34 2 262 3 truA tRNA pseudouridine synthase A Prochlorococcus marinus (strain AS9601)
P70973 2.15e-48 164 37 1 239 3 truA tRNA pseudouridine synthase A Bacillus subtilis (strain 168)
A3PLW1 2.44e-48 164 39 4 249 3 truA tRNA pseudouridine synthase A Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
A1AUF4 2.7e-48 163 38 0 242 3 truA tRNA pseudouridine synthase A Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
B9KKX4 3.3e-48 163 39 4 249 3 truA tRNA pseudouridine synthase A Cereibacter sphaeroides (strain KD131 / KCTC 12085)
A7NR34 3.59e-48 164 40 5 259 3 truA tRNA pseudouridine synthase A Roseiflexus castenholzii (strain DSM 13941 / HLO8)
Q8Y457 4.17e-48 163 36 3 240 3 truA tRNA pseudouridine synthase A Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q7TUP1 4.3e-48 164 36 2 260 3 truA tRNA pseudouridine synthase A Prochlorococcus marinus (strain MIT 9313)
Q6MQH6 5.49e-48 163 36 4 253 3 truA tRNA pseudouridine synthase A Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
Q71WI0 5.7e-48 162 35 3 240 3 truA tRNA pseudouridine synthase A Listeria monocytogenes serotype 4b (strain F2365)
C1KZ13 5.7e-48 162 35 3 240 3 truA tRNA pseudouridine synthase A Listeria monocytogenes serotype 4b (strain CLIP80459)
Q03MR4 7.96e-48 162 36 3 241 3 truA tRNA pseudouridine synthase A Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q04BY4 1.08e-47 162 37 3 245 3 truA tRNA pseudouridine synthase A Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q9REQ0 1.64e-47 161 37 3 241 3 truA tRNA pseudouridine synthase A Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
C1CLU3 1.7e-47 161 35 2 242 3 truA tRNA pseudouridine synthase A Streptococcus pneumoniae (strain P1031)
A8F9B7 1.87e-47 161 37 1 243 3 truA tRNA pseudouridine synthase A Bacillus pumilus (strain SAFR-032)
B8DB42 2.57e-47 160 35 3 240 3 truA tRNA pseudouridine synthase A Listeria monocytogenes serotype 4a (strain HCC23)
A8G737 2.95e-47 161 35 2 262 3 truA tRNA pseudouridine synthase A Prochlorococcus marinus (strain MIT 9215)
C0M8L4 3.14e-47 160 34 2 242 3 truA tRNA pseudouridine synthase A Streptococcus equi subsp. equi (strain 4047)
C0MFQ1 3.32e-47 160 34 2 242 3 truA tRNA pseudouridine synthase A Streptococcus equi subsp. zooepidemicus (strain H70)
C0QZT8 3.32e-47 160 34 2 248 3 truA tRNA pseudouridine synthase A Brachyspira hyodysenteriae (strain ATCC 49526 / WA1)
C1CFH9 4.84e-47 160 34 2 242 3 truA tRNA pseudouridine synthase A Streptococcus pneumoniae (strain JJA)
Q8CWQ1 4.84e-47 160 34 2 242 3 truA tRNA pseudouridine synthase A Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
B2IRB1 4.84e-47 160 34 2 242 3 truA tRNA pseudouridine synthase A Streptococcus pneumoniae (strain CGSP14)
B8ZM12 4.84e-47 160 34 2 242 3 truA tRNA pseudouridine synthase A Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
B1ID11 4.84e-47 160 34 2 242 3 truA tRNA pseudouridine synthase A Streptococcus pneumoniae (strain Hungary19A-6)
Q04JF7 4.84e-47 160 34 2 242 3 truA tRNA pseudouridine synthase A Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q2NCT7 4.98e-47 160 37 1 245 3 truA tRNA pseudouridine synthase A Erythrobacter litoralis (strain HTCC2594)
Q168C1 5.65e-47 160 39 4 246 3 truA tRNA pseudouridine synthase A Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
C5D3U9 5.89e-47 160 36 1 242 3 truA tRNA pseudouridine synthase A Geobacillus sp. (strain WCH70)
A4VZC6 6.4e-47 160 35 2 242 3 truA tRNA pseudouridine synthase A Streptococcus suis (strain 98HAH33)
Q814C2 6.52e-47 160 35 1 242 3 truA1 tRNA pseudouridine synthase A 1 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B5E6N8 6.97e-47 160 34 2 242 3 truA tRNA pseudouridine synthase A Streptococcus pneumoniae serotype 19F (strain G54)
A4WPU4 7.74e-47 160 39 4 249 3 truA tRNA pseudouridine synthase A Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
Q7V9Y7 8.32e-47 160 37 2 245 3 truA tRNA pseudouridine synthase A Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
B7IHS2 8.45e-47 159 36 4 241 3 truA tRNA pseudouridine synthase A Thermosipho africanus (strain TCF52B)
A4VT40 8.93e-47 159 35 2 242 3 truA tRNA pseudouridine synthase A Streptococcus suis (strain 05ZYH33)
A2BYR1 1.23e-46 160 36 1 244 3 truA tRNA pseudouridine synthase A Prochlorococcus marinus (strain MIT 9515)
B3CSN9 1.39e-46 160 35 7 277 3 truA tRNA pseudouridine synthase A Orientia tsutsugamushi (strain Ikeda)
B9DTJ0 1.85e-46 159 34 2 243 3 truA tRNA pseudouridine synthase A Streptococcus uberis (strain ATCC BAA-854 / 0140J)
Q7TTT1 1.86e-46 160 39 2 247 3 truA tRNA pseudouridine synthase A Parasynechococcus marenigrum (strain WH8102)
Q97EL1 1.89e-46 158 34 0 241 3 truA tRNA pseudouridine synthase A Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
A5CET3 2.04e-46 159 35 5 278 3 truA tRNA pseudouridine synthase A Orientia tsutsugamushi (strain Boryong)
Q8XHV5 2.23e-46 158 34 0 242 3 truA2 tRNA pseudouridine synthase A 2 Clostridium perfringens (strain 13 / Type A)
Q9PJT0 2.41e-46 159 38 4 256 3 truA tRNA pseudouridine synthase A Chlamydia muridarum (strain MoPn / Nigg)
B1YH83 3.28e-46 158 37 1 239 3 truA tRNA pseudouridine synthase A Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
Q5FM60 3.55e-46 158 36 3 249 3 truA tRNA pseudouridine synthase A Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q890R5 5.64e-46 157 32 1 244 3 truA2 tRNA pseudouridine synthase A 2 Clostridium tetani (strain Massachusetts / E88)
B4U545 6.19e-46 157 33 2 242 3 truA tRNA pseudouridine synthase A Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
Q8CXP1 6.28e-46 157 36 5 243 3 truA tRNA pseudouridine synthase A Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q6HPM7 7.02e-46 157 35 1 242 3 truA1 tRNA pseudouridine synthase A 1 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q63H59 7.02e-46 157 35 1 242 3 truA1 tRNA pseudouridine synthase A 1 Bacillus cereus (strain ZK / E33L)
Q6I4Q2 7.02e-46 157 35 1 242 3 truA1 tRNA pseudouridine synthase A 1 Bacillus anthracis
Q5L3Q7 8.93e-46 157 38 1 250 3 truA tRNA pseudouridine synthase A Geobacillus kaustophilus (strain HTA426)
A4IJL9 9.14e-46 157 39 1 241 3 truA tRNA pseudouridine synthase A Geobacillus thermodenitrificans (strain NG80-2)
A0ALT4 1.1e-45 157 35 3 240 3 truA tRNA pseudouridine synthase A Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q97PL0 1.14e-45 157 34 2 242 3 truA tRNA pseudouridine synthase A Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
C1C8I7 1.14e-45 157 34 2 242 3 truA tRNA pseudouridine synthase A Streptococcus pneumoniae (strain 70585)
Q2GF33 1.21e-45 156 38 3 239 3 truA tRNA pseudouridine synthase A Neorickettsia sennetsu (strain ATCC VR-367 / Miyayama)
Q7TU07 1.22e-45 157 34 3 272 3 truA tRNA pseudouridine synthase A Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Q927P1 1.28e-45 156 35 3 240 3 truA tRNA pseudouridine synthase A Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
C1CSL6 1.42e-45 156 34 2 242 3 truA tRNA pseudouridine synthase A Streptococcus pneumoniae (strain Taiwan19F-14)
A2RIH1 2e-45 156 35 3 240 3 truA tRNA pseudouridine synthase A Lactococcus lactis subsp. cremoris (strain MG1363)
Q5L6V3 2.33e-45 156 36 4 254 3 truA tRNA pseudouridine synthase A Chlamydia abortus (strain DSM 27085 / S26/3)
Q73F64 2.34e-45 155 35 1 242 3 truA1 tRNA pseudouridine synthase A 1 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q01WL4 2.69e-45 155 37 3 244 3 truA tRNA pseudouridine synthase A Solibacter usitatus (strain Ellin6076)
Q3K3S9 3.04e-45 155 33 2 243 3 truA tRNA pseudouridine synthase A Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
B0S2E1 3.31e-45 155 32 0 242 3 truA tRNA pseudouridine synthase A Finegoldia magna (strain ATCC 29328 / DSM 20472 / WAL 2508)
B5XIG6 3.8e-45 155 33 2 240 3 truA tRNA pseudouridine synthase A Streptococcus pyogenes serotype M49 (strain NZ131)
Q48RE4 3.8e-45 155 33 2 240 3 truA tRNA pseudouridine synthase A Streptococcus pyogenes serotype M28 (strain MGAS6180)
A2RCK6 3.8e-45 155 33 2 240 3 truA tRNA pseudouridine synthase A Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J4W4 3.8e-45 155 33 2 240 3 truA tRNA pseudouridine synthase A Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JF09 3.8e-45 155 33 2 240 3 truA tRNA pseudouridine synthase A Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1JK16 3.8e-45 155 33 2 240 3 truA tRNA pseudouridine synthase A Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1J9W8 3.8e-45 155 33 2 240 3 truA tRNA pseudouridine synthase A Streptococcus pyogenes serotype M12 (strain MGAS2096)
P65851 3.8e-45 155 33 2 240 3 truA tRNA pseudouridine synthase A Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5XA03 3.8e-45 155 33 2 240 3 truA tRNA pseudouridine synthase A Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P65850 3.8e-45 155 33 2 240 3 truA tRNA pseudouridine synthase A Streptococcus pyogenes serotype M1
A6LPU5 3.97e-45 155 32 0 242 3 truA tRNA pseudouridine synthase A Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
Q28LN3 4.5e-45 155 38 7 254 3 truA tRNA pseudouridine synthase A Jannaschia sp. (strain CCS1)
A1QYG5 4.96e-45 155 32 2 244 3 truA tRNA pseudouridine synthase A Borrelia turicatae (strain 91E135)
A6LLJ7 5.37e-45 155 36 4 241 3 truA tRNA pseudouridine synthase A Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429)
A8AVB3 7.9e-45 154 33 2 242 3 truA tRNA pseudouridine synthase A Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
Q8E7Q5 9.68e-45 154 32 2 243 3 truA tRNA pseudouridine synthase A Streptococcus agalactiae serotype III (strain NEM316)
Q8CX20 9.89e-45 154 32 2 243 3 truA tRNA pseudouridine synthase A Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P0DD47 1.15e-44 154 33 2 240 3 truA tRNA pseudouridine synthase A Streptococcus pyogenes serotype M3 (strain SSI-1)
P0DD46 1.15e-44 154 33 2 240 3 truA tRNA pseudouridine synthase A Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q8DWH1 1.16e-44 154 33 2 242 3 truA tRNA pseudouridine synthase A Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q5LNR0 1.37e-44 154 36 5 264 3 truA tRNA pseudouridine synthase A Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q7TU31 1.68e-44 154 35 1 245 3 truA tRNA pseudouridine synthase A Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
Q031N1 1.87e-44 154 35 3 240 3 truA tRNA pseudouridine synthase A Lactococcus lactis subsp. cremoris (strain SK11)
Q38UV3 2.39e-44 153 35 2 240 3 truA tRNA pseudouridine synthase A Latilactobacillus sakei subsp. sakei (strain 23K)
Q8KDR7 4.69e-44 152 37 2 245 3 truA tRNA pseudouridine synthase A Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
A3CQB8 5.17e-44 152 33 2 242 3 truA tRNA pseudouridine synthase A Streptococcus sanguinis (strain SK36)
B1I1B5 6.04e-44 152 36 3 250 3 truA tRNA pseudouridine synthase A Desulforudis audaxviator (strain MP104C)
A9BGW7 6.06e-44 152 35 4 245 3 truA tRNA pseudouridine synthase A Petrotoga mobilis (strain DSM 10674 / SJ95)
Q3AW68 6.71e-44 154 37 2 245 3 truA tRNA pseudouridine synthase A Synechococcus sp. (strain CC9902)
Q9Z7X4 8.23e-44 152 35 5 254 3 truA tRNA pseudouridine synthase A Chlamydia pneumoniae
B2S1K1 9.51e-44 151 33 0 237 3 truA tRNA pseudouridine synthase A Borrelia hermsii (strain HS1 / DAH)
Q45557 9.66e-44 151 33 4 245 3 truA tRNA pseudouridine synthase A Bacillus sp. (strain KSM-64)
B9DM46 1.1e-43 152 34 0 239 3 truA tRNA pseudouridine synthase A Staphylococcus carnosus (strain TM300)
Q03PY8 1.15e-43 152 34 2 243 3 truA tRNA pseudouridine synthase A Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q6ANM1 2.28e-43 150 34 1 249 3 truA1 tRNA pseudouridine synthase A 1 Desulfotalea psychrophila (strain LSv54 / DSM 12343)
Q253C0 3.67e-43 150 36 4 252 3 truA tRNA pseudouridine synthase A Chlamydia felis (strain Fe/C-56)
C4XPZ9 4.11e-43 150 36 5 263 3 truA tRNA pseudouridine synthase A Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
Q035B5 1.29e-42 149 35 2 240 3 truA tRNA pseudouridine synthase A Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
A8LNZ7 1.39e-42 149 39 6 251 3 truA tRNA pseudouridine synthase A Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
A3PF23 1.71e-42 149 34 2 260 3 truA tRNA pseudouridine synthase A Prochlorococcus marinus (strain MIT 9301)
B3WAI6 1.84e-42 148 35 2 240 3 truA tRNA pseudouridine synthase A Lacticaseibacillus casei (strain BL23)
Q4FNF9 2.9e-42 147 33 1 239 3 truA tRNA pseudouridine synthase A Pelagibacter ubique (strain HTCC1062)
Q6GEL6 3.83e-42 148 34 1 247 3 truA tRNA pseudouridine synthase A Staphylococcus aureus (strain MRSA252)
A5VDL9 4.7e-42 147 36 3 248 3 truA tRNA pseudouridine synthase A Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
Q88XU9 9.51e-42 147 34 3 247 3 truA tRNA pseudouridine synthase A Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
B2TIK9 1.07e-41 146 31 0 242 3 truA tRNA pseudouridine synthase A Clostridium botulinum (strain Eklund 17B / Type B)
B2A4Q5 1.14e-41 146 35 4 251 3 truA tRNA pseudouridine synthase A Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
Q3B3P4 1.86e-41 146 36 2 248 3 truA tRNA pseudouridine synthase A Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
Q5Z1K7 2.7e-41 145 39 3 238 3 truA tRNA pseudouridine synthase A Nocardia farcinica (strain IFM 10152)
Q1GE00 3.31e-41 145 36 4 249 3 truA tRNA pseudouridine synthase A Ruegeria sp. (strain TM1040)
Q2YYM7 4.74e-41 145 34 1 247 3 truA tRNA pseudouridine synthase A Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q9RS37 5.23e-41 145 35 4 251 3 truA tRNA pseudouridine synthase A Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
C6BW69 6.17e-41 145 36 4 252 3 truA tRNA pseudouridine synthase A Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
A7HKV8 7.94e-41 144 34 2 241 3 truA tRNA pseudouridine synthase A Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1)
B1HMV0 9.03e-41 144 35 4 253 3 truA tRNA pseudouridine synthase A Lysinibacillus sphaericus (strain C3-41)
C4KZL4 9.53e-41 144 32 2 249 3 truA tRNA pseudouridine synthase A Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
P65849 1.03e-40 144 33 1 247 3 truA tRNA pseudouridine synthase A Staphylococcus aureus (strain N315)
P65848 1.03e-40 144 33 1 247 3 truA tRNA pseudouridine synthase A Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5IV03 1.03e-40 144 33 1 247 3 truA tRNA pseudouridine synthase A Staphylococcus aureus (strain JH9)
A6U3U4 1.03e-40 144 33 1 247 3 truA tRNA pseudouridine synthase A Staphylococcus aureus (strain JH1)
A7X5B5 1.03e-40 144 33 1 247 3 truA tRNA pseudouridine synthase A Staphylococcus aureus (strain Mu3 / ATCC 700698)
A6LDA7 1.2e-40 144 36 6 253 3 truA tRNA pseudouridine synthase A Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
A8Z326 1.28e-40 144 34 1 247 3 truA tRNA pseudouridine synthase A Staphylococcus aureus (strain USA300 / TCH1516)
A6QJ61 1.28e-40 144 34 1 247 3 truA tRNA pseudouridine synthase A Staphylococcus aureus (strain Newman)
Q5HDY9 1.28e-40 144 34 1 247 3 truA tRNA pseudouridine synthase A Staphylococcus aureus (strain COL)
Q2FW37 1.28e-40 144 34 1 247 3 truA tRNA pseudouridine synthase A Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FES0 1.28e-40 144 34 1 247 3 truA tRNA pseudouridine synthase A Staphylococcus aureus (strain USA300)
B0SJC4 2.4e-40 143 33 7 260 3 truA tRNA pseudouridine synthase A Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris)
B0SC03 2.4e-40 143 33 7 260 3 truA tRNA pseudouridine synthase A Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames)
P70830 2.84e-40 142 32 1 238 3 truA tRNA pseudouridine synthase A Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
B2UYE4 3.71e-40 142 31 0 242 3 truA tRNA pseudouridine synthase A Clostridium botulinum (strain Alaska E43 / Type E3)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_14265
Feature type CDS
Gene truA
Product tRNA pseudouridine(38-40) synthase TruA
Location 52411 - 53232 (strand: -1)
Length 822 (nucleotides) / 273 (amino acids)
In genomic island -

Contig

Accession contig_18
Length 100673 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1954
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01416 tRNA pseudouridine synthase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0101 Translation, ribosomal structure and biogenesis (J) J tRNA U38,U39,U40 pseudouridine synthase TruA

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K06173 tRNA pseudouridine38-40 synthase [EC:5.4.99.12] - -

Protein Sequence

MSEVILPAEEGKTTIALGIEYDGSRYYGWQRQSEVASVQGCLEKALSKVAAEPVSVFCAGRTDAGVHATGQVVHFHTAAVRKDAAWTMGVNTHLPPDIAVRWVKTVPENFHARFSATARRYRYVIFNHRFRPAILSKGVTHFHYPLDEKRMHEAAQSLLGENDFSSFRAAQCQSRSPWRNVMHVNVTRQGQYVIVDIKANAFVHHMVRNITGALLEVGCGNLPVSRMAELLALKDRTQAPATAPAEGLYLVSVDYPEEFALPSPAMGPLFLAD

Flanking regions ( +/- flanking 50bp)

CTGATGGCAGTCGAAATTGCCGAGCGTCTGACGCAGGAGCAGTTTTACTGATGTCAGAGGTGATTTTACCGGCGGAAGAGGGTAAAACCACGATCGCGCTGGGCATTGAATATGACGGCAGCCGTTATTACGGCTGGCAGCGTCAGTCAGAAGTCGCGAGTGTGCAGGGCTGTCTGGAAAAAGCCCTGTCAAAAGTGGCTGCAGAGCCGGTCTCGGTTTTCTGTGCGGGCCGGACCGATGCCGGGGTGCATGCCACCGGCCAGGTGGTGCATTTTCATACGGCAGCTGTCCGTAAAGATGCCGCCTGGACGATGGGCGTAAACACCCATCTGCCGCCGGATATCGCGGTACGCTGGGTCAAGACCGTGCCGGAGAATTTTCACGCCCGGTTCAGTGCCACAGCGCGGCGTTACCGCTATGTGATTTTCAATCACCGCTTTCGTCCGGCTATCCTCAGCAAGGGTGTGACCCACTTTCATTATCCGCTGGATGAAAAGCGGATGCATGAAGCGGCACAGAGTCTGCTGGGGGAGAATGATTTTTCCTCTTTCCGCGCGGCGCAGTGTCAGTCCAGAAGCCCGTGGCGTAATGTGATGCATGTCAACGTCACCCGTCAGGGGCAGTATGTGATTGTGGATATCAAAGCCAATGCTTTTGTGCATCATATGGTGCGTAATATCACCGGCGCTCTGCTGGAGGTCGGCTGCGGTAATTTACCGGTCAGCCGGATGGCGGAGTTGCTGGCACTGAAAGACCGGACACAGGCACCGGCGACAGCACCGGCGGAAGGTTTGTATCTGGTTTCAGTGGATTACCCGGAAGAATTTGCCCTGCCGTCACCGGCGATGGGGCCGCTTTTCCTGGCAGATTAATTTATTGGCCGGATAAGCAGAAAGCCGCGTCCGGCGGGGTGAAATATGGA