Homologs in group_2922

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_19750 EHELCC_19750 96.4 Morganella morganii S2 - Minor tail T domain-containing protein
NLDBIP_19780 NLDBIP_19780 96.4 Morganella morganii S4 - Minor tail T domain-containing protein
LHKJJB_19745 LHKJJB_19745 100.0 Morganella morganii S3 - Minor tail T domain-containing protein
HKOGLL_06000 HKOGLL_06000 100.0 Morganella morganii S5 - Minor tail T domain-containing protein
F4V73_RS02195 F4V73_RS02195 67.9 Morganella psychrotolerans - phage tail assembly protein T

Distribution of the homologs in the orthogroup group_2922

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2922

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P03735 1.55e-11 61 37 0 81 1 T Tail assembly protein GT Escherichia phage lambda
O64329 0.000121 42 33 1 84 3 gene Tail assembly protein GT Escherichia phage N15 15

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_13070
Feature type CDS
Gene -
Product Minor tail T domain-containing protein
Location 9775 - 10029 (strand: -1)
Length 255 (nucleotides) / 84 (amino acids)
In genomic island -

Contig

Accession contig_16
Length 109220 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2922
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF06223 Minor tail protein T

Protein Sequence

MTATELGDWYTYFGVTPFTYQLIDLEFAALSNTMVSLVGGSKDLSLNDFLLLKHSEETGETDDSLLMTAGEGIAGGVRYEPADS

Flanking regions ( +/- flanking 50bp)

GCCTCGCTCATGAATTTAAACGGGCGGACTGGCGCAGGATGCTGGCGGATATGACGGCAACAGAGCTGGGGGACTGGTACACCTATTTCGGGGTAACGCCATTCACTTATCAGCTGATTGATCTGGAGTTCGCCGCACTCAGTAACACCATGGTGTCGCTGGTGGGCGGCAGCAAAGACCTGTCGCTGAATGATTTTCTGTTACTGAAACACAGCGAAGAAACCGGTGAGACTGACGACTCACTGTTAATGACAGCAGGCGAGGGGATCGCCGGGGGAGTACGTTATGAGCCAGCAGATAGCTGATCTGGTCATTAATCTCAGTGCGGACAGCACCACATTCACTGAGCAGGTTG