Homologs in group_3924
0 homologs were identified in 0 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.
| Locus tag | Identity | Source | Gene | Product |
|---|
Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).
| Swissprot accession | Eval | Score | ID (%) | N gaps | Alignment length | Annot score | Gene | Description | Organism |
|---|---|---|---|---|---|---|---|---|---|
| Q61140 | 0.000501 | 41 | 34 | 1 | 52 | 1 | Bcar1 | Breast cancer anti-estrogen resistance protein 1 | Mus musculus |
| Q63767 | 0.000505 | 41 | 34 | 1 | 52 | 1 | Bcar1 | Breast cancer anti-estrogen resistance protein 1 | Rattus norvegicus |
| P56945 | 0.00067 | 41 | 34 | 1 | 52 | 1 | BCAR1 | Breast cancer anti-estrogen resistance protein 1 | Homo sapiens |
| Source | Morganella morganii S1 |
|---|---|
| Locus tag | FBDBKF_12805 |
| Feature type | CDS |
| Gene | - |
| Product | SH3 domain-containing protein |
| Location | 69606 - 69959 (strand: 1) |
| Length | 354 (nucleotides) / 117 (amino acids) |
| Accession | contig_15 |
|---|---|
| Length | 114235 nucleotides |
| Topology | linear |
| Plasmid | False |
| Orthogroup | group_3924 | |
|---|---|---|
| Orthogroup size | 1 | |
| N. genomes | 1 |
| PF07653 | Variant SH3 domain |
|---|
MKKQLIVIKRHISEYPNPIHFSAGDSLTVGEKYVGDEGWDNWYLCSFNGLSGWVPKQIIELISETTGIAKENYSALELNVETQEHVIGYKETNGWVWCKKLDTGEQGWLPVSNLKEI
GTAATTTTCCAGTATGATAGTCAAAGTTAAAAACTATTATTGGTAACGTAATGAAAAAACAGTTAATTGTGATTAAGAGACATATTTCTGAGTACCCTAATCCCATTCATTTCTCTGCCGGTGACTCGCTGACTGTAGGCGAAAAATACGTAGGAGATGAGGGCTGGGATAATTGGTATCTTTGCTCGTTTAACGGTTTAAGTGGTTGGGTTCCTAAGCAGATAATTGAATTAATTAGCGAAACTACAGGAATTGCCAAAGAAAACTATAGTGCATTGGAACTGAATGTGGAGACACAGGAACATGTCATTGGATACAAAGAAACCAATGGTTGGGTTTGGTGCAAAAAATTGGATACAGGAGAGCAAGGCTGGCTCCCTGTATCAAATCTAAAAGAAATTTAGTGAATTAGCTCTACTTTAACAAACTGCCTGAATAACATTAATCCGATTTA
