Homologs in group_4778

Help

0 homologs were identified in 0 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product

Distribution of the homologs in the orthogroup group_4778

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_4778

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q61140 0.000501 41 34 1 52 1 Bcar1 Breast cancer anti-estrogen resistance protein 1 Mus musculus
Q63767 0.000505 41 34 1 52 1 Bcar1 Breast cancer anti-estrogen resistance protein 1 Rattus norvegicus
P56945 0.00067 41 34 1 52 1 BCAR1 Breast cancer anti-estrogen resistance protein 1 Homo sapiens

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_12805
Feature type CDS
Gene -
Product SH3 domain-containing protein
Location 69606 - 69959 (strand: 1)
Length 354 (nucleotides) / 117 (amino acids)
In genomic island -

Contig

Accession contig_15
Length 114235 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_4778
Orthogroup size 1
N. genomes 1

Actions

Genomic region

Domains

PF07653 Variant SH3 domain

Protein Sequence

MKKQLIVIKRHISEYPNPIHFSAGDSLTVGEKYVGDEGWDNWYLCSFNGLSGWVPKQIIELISETTGIAKENYSALELNVETQEHVIGYKETNGWVWCKKLDTGEQGWLPVSNLKEI

Flanking regions ( +/- flanking 50bp)

GTAATTTTCCAGTATGATAGTCAAAGTTAAAAACTATTATTGGTAACGTAATGAAAAAACAGTTAATTGTGATTAAGAGACATATTTCTGAGTACCCTAATCCCATTCATTTCTCTGCCGGTGACTCGCTGACTGTAGGCGAAAAATACGTAGGAGATGAGGGCTGGGATAATTGGTATCTTTGCTCGTTTAACGGTTTAAGTGGTTGGGTTCCTAAGCAGATAATTGAATTAATTAGCGAAACTACAGGAATTGCCAAAGAAAACTATAGTGCATTGGAACTGAATGTGGAGACACAGGAACATGTCATTGGATACAAAGAAACCAATGGTTGGGTTTGGTGCAAAAAATTGGATACAGGAGAGCAAGGCTGGCTCCCTGTATCAAATCTAAAAGAAATTTAGTGAATTAGCTCTACTTTAACAAACTGCCTGAATAACATTAATCCGATTTA