Homologs in group_3761

Help

1 homologs were identified in 1 genome with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
PMI_RS09745 PMI_RS09745 66.1 Proteus mirabilis HI4320 - phage tail sheath protein

Distribution of the homologs in the orthogroup group_3761

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3761

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P22501 6.73e-11 58 73 0 34 1 FI Tail sheath protein Escherichia phage P2
Q6QIB0 9.69e-05 41 48 0 35 3 BcepMu39 Tail sheath protein Burkholderia phage BcepMu (isolate -/United States/Summer/2002)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_12675
Feature type CDS
Gene -
Product Phage tail sheath protein
Location 46726 - 46920 (strand: 1)
Length 195 (nucleotides) / 64 (amino acids)

Contig

Accession contig_15
Length 114235 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3761
Orthogroup size 2
N. genomes 2

Actions

Genomic region

Protein Sequence

MSQKYHHGVRVIEHNNGTRPIRTVSTAVIGMVCTANDAGLLNENDIPPYPRRWFPFPGFPQETN

Flanking regions ( +/- flanking 50bp)

ACAGAATCACATCAATAACACCATAGAAAATCTCAATAAAGGGAATTTCTATGTCACAAAAATATCACCACGGCGTGCGTGTTATTGAGCACAATAACGGTACCCGGCCAATCCGCACAGTCAGCACGGCCGTTATCGGCATGGTCTGTACAGCAAATGATGCCGGTCTGCTGAATGAAAACGACATCCCCCCTTATCCGCGAAGATGGTTTCCGTTTCCGGGGTTCCCGCAAGAAACAAATTAAAGGCTGGACTGACAGATTGCCTAAAGTCATAAAAATGGCTGAAACCTTGC