Homologs in group_1723

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_17645 EHELCC_17645 100.0 Morganella morganii S2 efeO Iron uptake system EfeUOB, periplasmic (or lipoprotein) component EfeO/EfeM
NLDBIP_19315 NLDBIP_19315 100.0 Morganella morganii S4 efeO Iron uptake system EfeUOB, periplasmic (or lipoprotein) component EfeO/EfeM
LHKJJB_18085 LHKJJB_18085 100.0 Morganella morganii S3 efeO Iron uptake system EfeUOB, periplasmic (or lipoprotein) component EfeO/EfeM
HKOGLL_18995 HKOGLL_18995 100.0 Morganella morganii S5 efeO Iron uptake system EfeUOB, periplasmic (or lipoprotein) component EfeO/EfeM
F4V73_RS07970 F4V73_RS07970 76.3 Morganella psychrotolerans - EfeM/EfeO family lipoprotein
PMI_RS00840 PMI_RS00840 41.6 Proteus mirabilis HI4320 - EfeM/EfeO family lipoprotein

Distribution of the homologs in the orthogroup group_1723

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1723

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q1CHD4 4.19e-39 144 34 4 294 3 efeO Iron uptake system component EfeO Yersinia pestis bv. Antiqua (strain Nepal516)
Q0WFT9 4.19e-39 144 34 4 294 1 efeO Iron uptake system component EfeO Yersinia pestis
Q1C8M2 4.19e-39 144 34 4 294 3 efeO Iron uptake system component EfeO Yersinia pestis bv. Antiqua (strain Antiqua)
Q9K1P6 1.66e-38 142 33 2 246 1 NMB0035 Efem/EfeO family lipoprotein NMB0035 Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q66BP5 2.31e-38 142 36 2 241 3 efeO Iron uptake system component EfeO Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1RDJ9 3.46e-35 133 37 2 217 3 efeO Iron uptake system component EfeO Escherichia coli (strain UTI89 / UPEC)
A1A9S2 3.46e-35 133 37 2 217 3 efeO Iron uptake system component EfeO Escherichia coli O1:K1 / APEC
Q8FJ35 3.72e-35 133 37 2 217 2 efeO Iron uptake system component EfeO Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TJ49 4e-35 133 37 2 217 3 efeO Iron uptake system component EfeO Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q3Z397 4.13e-35 133 37 2 217 3 efeO Iron uptake system component EfeO Shigella sonnei (strain Ss046)
P0AB25 4.13e-35 133 37 2 217 3 efeO Iron uptake system component EfeO Shigella flexneri
Q0T617 4.13e-35 133 37 2 217 3 efeO Iron uptake system component EfeO Shigella flexneri serotype 5b (strain 8401)
P0AB24 4.13e-35 133 37 2 217 1 efeO Iron uptake system component EfeO Escherichia coli (strain K12)
Q8XAS6 5.41e-35 133 37 2 217 1 efeO Iron uptake system component EfeO Escherichia coli O157:H7
Q31Z85 3.39e-34 130 36 2 217 3 efeO Iron uptake system component EfeO Shigella boydii serotype 4 (strain Sb227)
Q4ZR20 1.93e-30 119 31 3 242 1 efeM Iron uptake system component EfeM Pseudomonas syringae pv. syringae (strain B728a)
P39596 8.55e-20 91 27 2 210 1 efeM Iron uptake system component EfeM Bacillus subtilis (strain 168)
Q4L8N2 4.18e-18 85 26 3 211 3 SH0684 Efem/EfeO family lipoprotein Staphylococcus haemolyticus (strain JCSC1435)
Q6GJX5 4.52e-18 85 25 3 213 3 SAR0340 Efem/EfeO family lipoprotein Staphylococcus aureus (strain MRSA252)
Q8NYA3 1.68e-17 84 25 3 213 3 MW0319 Efem/EfeO family lipoprotein Staphylococcus aureus (strain MW2)
Q6GCC9 1.68e-17 84 25 3 213 3 SAS0319 Efem/EfeO family lipoprotein Staphylococcus aureus (strain MSSA476)
Q7A7M3 2.74e-17 83 25 3 213 3 SA0331 Efem/EfeO family lipoprotein Staphylococcus aureus (strain N315)
Q99WN4 2.74e-17 83 25 3 213 3 SAV0343 Efem/EfeO family lipoprotein Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HIV1 2.74e-17 83 25 3 213 3 SACOL0414 Efem/EfeO family lipoprotein Staphylococcus aureus (strain COL)
Q2YVG5 2.74e-17 83 25 3 213 3 SAB0293 Efem/EfeO family lipoprotein Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2G131 2.74e-17 83 25 3 213 3 SAOUHSC_00325 Efem/EfeO family lipoprotein Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FJS0 5.71e-17 82 25 3 213 3 SAUSA300_0344 Efem/EfeO family lipoprotein Staphylococcus aureus (strain USA300)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_11725
Feature type CDS
Gene efeO
Product Iron uptake system EfeUOB, periplasmic (or lipoprotein) component EfeO/EfeM
Location 131739 - 132638 (strand: 1)
Length 900 (nucleotides) / 299 (amino acids)
In genomic island -

Contig

Accession contig_13
Length 135581 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1723
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF09375 Imelysin

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2822 Inorganic ion transport and metabolism (P) P Iron uptake system EfeUOB, periplasmic (or lipoprotein) component EfeO/EfeM

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07224 iron uptake system component EfeO - -

Protein Sequence

MRINRTAVLVLTSLLLSAPGYAEKYRAGNPDTGSDVVIAKGDIPSPEKFRPVVADYMTMMGKQTAAAEHQLQLLQKALAVGDMAAARQAYIQAHYDYEVIRAAVVVFGHADRVINPHAGYFLIREQDPKFTGFHRIEYALFAQNDPAAAQAATADLLRNINDLKQRIDVETLPAAKLVQSADDSIELILSTKLSGDENRYSRSDLSDIAANIEGTRRIVSGLAPLLSAKTNEALRKQFAGPDAVMARYRDTRGQYAEYEKLTPEDKQQLYADLTLLAESLAQLRAELKIDVYYKYRNEP

Flanking regions ( +/- flanking 50bp)

GGTGTACTGGCTGGTGATTATTGCGCTGTTCTGCCGCAGAGGAAAAAAACATGCGGATTAACCGGACAGCCGTACTGGTTCTGACATCACTGCTGCTCAGCGCTCCCGGCTATGCGGAAAAATACCGTGCAGGTAATCCGGATACCGGCAGTGATGTGGTGATCGCCAAAGGGGATATTCCGTCACCGGAAAAATTCCGTCCGGTTGTGGCGGATTACATGACGATGATGGGGAAACAGACAGCTGCGGCTGAACATCAGCTGCAATTGCTGCAAAAAGCGCTGGCCGTGGGGGATATGGCAGCTGCACGGCAGGCTTATATTCAGGCACATTATGATTATGAGGTTATCCGCGCGGCAGTGGTGGTTTTCGGTCACGCTGACCGGGTTATTAACCCTCATGCCGGCTATTTTCTCATCCGCGAGCAGGATCCGAAATTCACCGGGTTTCACCGCATCGAATATGCGCTGTTTGCTCAAAATGATCCCGCAGCCGCTCAGGCCGCTACCGCCGATCTGCTGCGCAATATTAATGACCTGAAACAGCGGATCGACGTGGAAACCCTCCCTGCGGCAAAGCTGGTCCAGTCTGCGGATGACAGTATTGAACTGATTCTCAGCACTAAACTGAGTGGTGATGAAAACCGCTACAGCCGTTCGGATCTGTCAGATATCGCCGCCAATATTGAAGGGACCCGGCGCATTGTCAGCGGGCTGGCGCCGTTATTATCCGCAAAAACCAATGAGGCACTCAGAAAGCAGTTTGCGGGACCGGATGCGGTCATGGCCCGTTATCGGGATACCCGGGGGCAGTATGCGGAATATGAGAAACTGACACCGGAAGATAAACAGCAACTCTATGCAGACCTGACGCTGCTGGCAGAATCTCTGGCACAACTGCGCGCTGAACTGAAAATAGACGTGTATTACAAATACCGGAATGAACCATGAAACACGGCAAAGTGAATCTGACTGAGACAGAAGAGTCTGTCAGTCTCAGC