Homologs in group_3335

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_17990 EHELCC_17990 100.0 Morganella morganii S2 - Fumarate hydratase
NLDBIP_05320 NLDBIP_05320 100.0 Morganella morganii S4 - Fumarate hydratase
LHKJJB_02200 LHKJJB_02200 100.0 Morganella morganii S3 - Fumarate hydratase
HKOGLL_15580 HKOGLL_15580 100.0 Morganella morganii S5 - Fumarate hydratase

Distribution of the homologs in the orthogroup group_3335

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3335

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_11225
Feature type CDS
Gene -
Product Fumarate hydratase
Location 63002 - 63202 (strand: 1)
Length 201 (nucleotides) / 66 (amino acids)

Contig

Accession contig_13
Length 135581 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3335
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Protein Sequence

MTEAEQREHYEKIMGWIGKVLMYTLHSRGNVICRDDLIDELRQHKKEAPTKEIKALLNDAIKMVER

Flanking regions ( +/- flanking 50bp)

CACAGTTATGGTTAATAAGTAGCCATCATGACGAAAAGATAGGGGGATTTATGACCGAAGCAGAACAGCGTGAGCACTACGAGAAGATAATGGGATGGATCGGCAAAGTGCTGATGTACACACTGCACAGTCGCGGTAATGTCATTTGCCGGGATGATTTGATAGATGAACTCAGGCAGCATAAGAAAGAAGCACCGACGAAGGAAATCAAGGCGTTACTGAATGACGCGATAAAGATGGTAGAGAGATAGGCACAAAAAAGCCCTCGCGGAGAGGGCTTTTTTACTGAGGAAAGCTTGCT