Homologs in group_1602

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_04870 EHELCC_04870 100.0 Morganella morganii S2 rsfS ribosome silencing factor
NLDBIP_04870 NLDBIP_04870 100.0 Morganella morganii S4 rsfS ribosome silencing factor
LHKJJB_13760 LHKJJB_13760 100.0 Morganella morganii S3 rsfS ribosome silencing factor
HKOGLL_12775 HKOGLL_12775 100.0 Morganella morganii S5 rsfS ribosome silencing factor
F4V73_RS00265 F4V73_RS00265 92.6 Morganella psychrotolerans rsfS ribosome silencing factor
PMI_RS02110 PMI_RS02110 82.4 Proteus mirabilis HI4320 rsfS ribosome silencing factor

Distribution of the homologs in the orthogroup group_1602

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1602

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AAT8 4.28e-49 154 68 0 105 3 rsfS Ribosomal silencing factor RsfS Shigella flexneri
P0AAT6 4.28e-49 154 68 0 105 1 rsfS Ribosomal silencing factor RsfS Escherichia coli (strain K12)
P0AAT7 4.28e-49 154 68 0 105 3 rsfS Ribosomal silencing factor RsfS Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P44471 3.9e-42 136 60 0 100 3 rsfS Ribosomal silencing factor RsfS Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q02SH2 1.59e-33 115 49 0 104 1 rsfS Ribosomal silencing factor RsfS Pseudomonas aeruginosa (strain UCBPP-PA14)
Q97P97 2.84e-22 87 38 0 100 1 rsfS Ribosomal silencing factor RsfS Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q5NLX3 4.89e-21 84 38 0 99 1 rsfS Ribosomal silencing factor RsfS Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q9KD89 6.02e-19 78 31 0 104 1 rsfS Ribosomal silencing factor RsfS Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q7P0P8 8.12e-18 75 36 0 100 1 rsfS Ribosomal silencing factor RsfS Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q9CWV0 4.26e-16 73 35 2 104 1 Malsu1 Mitochondrial assembly of ribosomal large subunit protein 1 Mus musculus
Q96EH3 8.94e-16 72 34 2 104 1 MALSU1 Mitochondrial assembly of ribosomal large subunit protein 1 Homo sapiens
P73658 1.12e-14 68 33 1 96 1 rsfS Ribosomal silencing factor RsfS Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q9CAF9 4.53e-11 59 34 3 98 2 At1g67620 Protein Iojap-related, mitochondrial Arabidopsis thaliana
P54457 1.27e-10 57 34 0 90 3 rsfS Ribosomal silencing factor RsfS Bacillus subtilis (strain 168)
P34523 1.5e-08 53 29 4 117 3 K12H4.2 Uncharacterized protein K12H4.2 Caenorhabditis elegans
O83720 1.19e-06 46 28 4 100 1 rsfS Ribosomal silencing factor RsfS Treponema pallidum (strain Nichols)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_10070
Feature type CDS
Gene rsfS
Product ribosome silencing factor
Location 106678 - 107004 (strand: 1)
Length 327 (nucleotides) / 108 (amino acids)
In genomic island -

Contig

Accession contig_11
Length 143616 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1602
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF02410 Ribosomal silencing factor during starvation

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0799 Translation, ribosomal structure and biogenesis (J) J Ribosomal silencing factor RsfS, regulates association of 30S and 50S subunits

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K09710 ribosome-associated protein - -

Protein Sequence

MNLLQGTELLEFIIDKLEDSKAQDIITIDVRGKSSITDHMIICTGTSSRHLASVADNLVTDCRQAGMMPLGVEGQGISDWIVVDLGEAIVHVMQDESRRMYELEKLWS

Flanking regions ( +/- flanking 50bp)

GGTACGACTGACGGGGATGTGTTCTGTTATCTATTTATCCGGAATATAAGGTGAACCTTTTGCAAGGCACAGAATTACTTGAGTTTATTATTGATAAACTCGAAGACTCCAAAGCACAGGACATTATTACTATTGATGTACGCGGTAAATCCAGCATTACCGACCACATGATTATCTGTACCGGCACATCCAGCCGCCATCTGGCGTCTGTGGCCGATAACCTTGTCACTGACTGCCGTCAGGCCGGTATGATGCCGCTCGGCGTGGAAGGTCAGGGCATTTCCGACTGGATTGTTGTCGATCTCGGTGAAGCTATCGTGCATGTGATGCAGGATGAAAGCCGCCGTATGTATGAATTAGAGAAACTCTGGAGCTGAGTGTTGAAGTTACAGCTCATTGCCGTCGGCACCAAAATGCCTGACTGGGT