Homologs in group_1540

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_04785 EHELCC_04785 100.0 Morganella morganii S2 corC CNNM family magnesium/cobalt transport protein CorC
NLDBIP_04785 NLDBIP_04785 100.0 Morganella morganii S4 corC CNNM family magnesium/cobalt transport protein CorC
LHKJJB_13845 LHKJJB_13845 100.0 Morganella morganii S3 corC CNNM family magnesium/cobalt transport protein CorC
HKOGLL_12690 HKOGLL_12690 100.0 Morganella morganii S5 corC CNNM family magnesium/cobalt transport protein CorC
F4V73_RS00360 F4V73_RS00360 97.6 Morganella psychrotolerans corC CNNM family magnesium/cobalt transport protein CorC
PMI_RS02190 PMI_RS02190 86.0 Proteus mirabilis HI4320 corC CNNM family magnesium/cobalt transport protein CorC

Distribution of the homologs in the orthogroup group_1540

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1540

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0A2L3 8.92e-170 474 83 0 292 1 corC Magnesium and cobalt efflux protein CorC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2L4 8.92e-170 474 83 0 292 3 corC Magnesium and cobalt efflux protein CorC Salmonella typhi
P0AE81 1.09e-169 474 83 0 292 3 corC Magnesium and cobalt efflux protein CorC Shigella flexneri
P0AE78 1.09e-169 474 83 0 292 1 corC Magnesium and cobalt efflux protein CorC Escherichia coli (strain K12)
P0AE79 1.09e-169 474 83 0 292 3 corC Magnesium and cobalt efflux protein CorC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AE80 1.09e-169 474 83 0 292 3 corC Magnesium and cobalt efflux protein CorC Escherichia coli O157:H7
Q8K9C0 3.63e-136 389 64 1 284 3 corC Magnesium and cobalt efflux protein CorC Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P57518 2.68e-132 380 66 1 284 3 corC Magnesium and cobalt efflux protein CorC Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q9KTE3 7.36e-127 366 66 2 283 3 corC Magnesium and cobalt efflux protein CorC Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q9CM13 2.47e-123 357 64 1 286 3 corC Magnesium and cobalt efflux protein CorC Pasteurella multocida (strain Pm70)
Q89AC1 1.77e-119 347 58 2 282 3 corC Magnesium and cobalt efflux protein CorC Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q57368 1.3e-118 345 61 2 296 3 corC Magnesium and cobalt efflux protein CorC Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P67131 1.23e-46 165 37 4 236 3 BQ2027_MB2387C UPF0053 protein Mb2387c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WFP1 1.23e-46 165 37 4 236 1 Rv2366c UPF0053 protein Rv2366c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WFP0 1.23e-46 165 37 4 236 3 MT2435 UPF0053 protein MT2435 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O05241 1.32e-37 141 32 4 269 3 yugS UPF0053 protein YugS Bacillus subtilis (strain 168)
P54428 9.29e-37 139 33 4 257 3 yrkA UPF0053 protein YrkA Bacillus subtilis (strain 168)
O07589 1.29e-36 139 34 3 257 3 yhdT UPF0053 protein YhdT Bacillus subtilis (strain 168)
Q54318 1.82e-35 131 35 5 245 3 tlyC Hemolysin C Brachyspira hyodysenteriae
P54505 4.79e-35 134 33 5 260 3 yqhB UPF0053 protein YqhB Bacillus subtilis (strain 168)
O05961 1.17e-34 130 29 8 306 2 tlyC Hemolysin C Rickettsia prowazekii (strain Madrid E)
P9WFP3 2.85e-33 129 30 2 228 1 Rv1842c UPF0053 protein Rv1842c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q4UK99 5.14e-33 125 30 7 274 3 tlyC Hemolysin C Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q9LK65 1.08e-32 130 31 6 265 4 CBSDUFCH1 Putative DUF21 domain-containing protein At3g13070, chloroplastic Arabidopsis thaliana
Q84R21 1.09e-32 130 31 5 265 2 CBSDUFCH2 DUF21 domain-containing protein At1g55930, chloroplastic Arabidopsis thaliana
Q1RGX2 1.55e-32 124 28 7 274 3 tlyC Possible hemolysin C Rickettsia bellii (strain RML369-C)
O07585 1.56e-32 127 35 2 216 3 yhdP UPF0053 protein YhdP Bacillus subtilis (strain 168)
P9WFP2 3.04e-32 127 30 2 228 3 MT1890 UPF0053 protein MT1890 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A8EZU0 3.05e-32 124 30 6 262 3 tlyC Possible hemolysin C Rickettsia canadensis (strain McKiel)
A8GUH1 3.43e-32 124 29 7 275 3 tlyC Possible hemolysin C Rickettsia bellii (strain OSU 85-389)
A8GPR9 5.49e-32 123 32 5 236 3 tlyC Possible hemolysin C Rickettsia akari (strain Hartford)
Q92GI2 1.35e-31 122 29 7 274 3 tlyC Hemolysin C homolog Rickettsia conorii (strain ATCC VR-613 / Malish 7)
A8GTI4 2.63e-31 121 29 7 274 3 tlyC Hemolysin C homolog Rickettsia rickettsii (strain Sheila Smith)
A8F2M1 9.91e-31 120 30 6 263 3 tlyC Hemolysin C homolog Rickettsia massiliae (strain Mtu5)
Q68W10 9.27e-30 117 28 7 282 1 tlyC Hemolysin C Rickettsia typhi (strain ATCC VR-144 / Wilmington)
P74409 1.81e-27 114 30 4 248 3 sll0260 UPF0053 protein sll0260 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P74078 3.54e-27 111 35 2 179 3 sll1254 UPF0053 protein sll1254 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q8K9M0 3.41e-23 102 28 4 222 3 BUsg_314 UPF0053 protein BUsg_314 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P57408 2.05e-22 100 28 9 280 3 BU323 UPF0053 protein BU323 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q48445 2.77e-22 97 28 5 240 3 None UPF0053 protein in cps region (Fragment) Klebsiella pneumoniae
P37908 5.05e-21 95 27 3 233 1 yfjD UPF0053 inner membrane protein YfjD Escherichia coli (strain K12)
Q83KI8 4.56e-20 93 26 4 240 3 yegH UPF0053 protein YegH Shigella flexneri
P76389 4.83e-20 93 26 4 240 3 yegH UPF0053 protein YegH Escherichia coli (strain K12)
P0AEC0 7.1e-20 92 30 3 225 1 yoaE UPF0053 inner membrane protein YoaE Escherichia coli (strain K12)
P0AEC1 7.1e-20 92 30 3 225 3 yoaE UPF0053 inner membrane protein YoaE Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AEC2 7.1e-20 92 30 3 225 3 yoaE UPF0053 inner membrane protein YoaE Escherichia coli O157:H7
P44717 1.65e-19 91 24 5 270 3 paeA Polyamine export protein Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q89AI6 2.82e-18 88 28 6 225 3 bbp_300 UPF0053 protein bbp_300 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q57017 5.03e-17 84 26 4 230 1 HI_0107 UPF0053 protein HI_0107 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P75586 3.7e-16 81 28 0 174 3 MPN_159 UPF0053 protein MG146 homolog Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q49399 6.11e-16 80 26 0 179 3 MG146 UPF0053 protein MG146 Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
P0AE45 8.29e-15 77 21 4 267 1 paeA Polyamine export protein Escherichia coli (strain K12)
P0AE46 8.29e-15 77 21 4 267 3 paeA Polyamine export protein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AE47 8.29e-15 77 21 4 267 3 paeA Polyamine export protein Escherichia coli O157:H7
A0A0F6BAS6 8.52e-15 77 22 5 281 3 paeA Polyamine export protein Salmonella typhimurium (strain 14028s / SGSC 2262)
P0C588 7.89e-10 63 28 5 186 1 Cnnm4 Metal transporter CNNM4 Rattus norvegicus
Q9ZQR4 1.04e-09 62 31 3 119 2 CBSDUF3 DUF21 domain-containing protein At2g14520 Arabidopsis thaliana
Q69ZF7 1.52e-09 62 28 5 186 1 Cnnm4 Metal transporter CNNM4 Mus musculus
Q8VZI2 1.77e-09 61 32 3 121 1 CBSDUF6 DUF21 domain-containing protein At4g33700 Arabidopsis thaliana
Q6P4Q7 1.93e-09 62 29 6 182 1 CNNM4 Metal transporter CNNM4 Homo sapiens
Q32NY4 2.17e-09 61 31 8 185 1 Cnnm3 Metal transporter CNNM3 Mus musculus
A0JPA0 2.57e-09 61 28 5 181 2 cnnm4 Metal transporter CNNM4 Xenopus tropicalis
Q9H8M5 3.91e-09 61 27 5 194 1 CNNM2 Metal transporter CNNM2 Homo sapiens
Q5U2P1 3.95e-09 60 27 5 194 2 Cnnm2 Metal transporter CNNM2 Rattus norvegicus
Q3TWN3 4.13e-09 60 27 5 194 1 Cnnm2 Metal transporter CNNM2 Mus musculus
Q12296 2.32e-08 58 27 5 155 1 MAM3 Protein MAM3 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P9WLQ7 4.59e-08 57 28 4 168 1 Rv1841c Uncharacterized protein Rv1841c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WLQ6 4.64e-08 57 28 4 168 3 MT1889 Uncharacterized protein MT1889 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q8NE01 6.62e-08 57 30 8 185 1 CNNM3 Metal transporter CNNM3 Homo sapiens
Q4V3C7 1.04e-07 56 29 2 126 2 CBSDUF2 DUF21 domain-containing protein At4g14230 Arabidopsis thaliana
Q67XQ0 1.58e-07 55 29 2 115 1 CBSDUF1 DUF21 domain-containing protein At4g14240 Arabidopsis thaliana
Q9LTD8 2.55e-07 55 31 2 118 2 CBSDUF5 DUF21 domain-containing protein At5g52790 Arabidopsis thaliana
Q8RY60 5.75e-07 54 28 3 118 1 CBSDUF7 DUF21 domain-containing protein At1g47330 Arabidopsis thaliana
A0A0B7P9G0 1.73e-06 52 29 5 182 1 uex Unextended protein Drosophila melanogaster
Q9NRU3 3.82e-06 52 25 6 162 1 CNNM1 Metal transporter CNNM1 Homo sapiens
Q0GA42 4.25e-06 51 25 6 162 1 Cnnm1 Metal transporter CNNM1 Mus musculus
Q9ZVS8 9.13e-06 50 30 2 111 4 CBSDUF4 Putative DUF21 domain-containing protein At1g03270 Arabidopsis thaliana
G5ED05 2.9e-05 48 23 7 185 3 cnnm-5 Metal transporter cnnm-5 Caenorhabditis elegans
Q9GYL2 5.15e-05 48 27 5 144 3 cnnm-2 Metal transporter cnnm-2 Caenorhabditis elegans
A0A131MCZ8 0.00079 44 28 5 144 2 cnnm-3 Metal transporter cnnm-3 Caenorhabditis elegans

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_09985
Feature type CDS
Gene corC
Product CNNM family magnesium/cobalt transport protein CorC
Location 89798 - 90688 (strand: 1)
Length 891 (nucleotides) / 296 (amino acids)

Contig

Accession contig_11
Length 143616 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1540
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00571 CBS domain
PF03471 Transporter associated domain
PF21917 N-terminal region of NMB0537

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4535 Inorganic ion transport and metabolism (P) P Mg2+ and Co2+ transporter CorC, contains CBS pair and CorC-HlyC domains

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K06189 hemolysin (HlyC) family protein - -

Protein Sequence

MSDDHPSGSDTPNQKKGFFSLLRQQLFHGEPKSREDLVEVIRDSEQNALIDPDTRDMLEGVMDISDQRVRDIMIPRSQIVTLKRNQTLDECLDVIIDSAHSRFPVISEDKDHIEGLLMAKDLLPFMRSDSEEFSIDKVLRQAVVVPESKRVDRLLKEFRSQRYHMAIVIDEFGGVSGLVTIEDILELIVGEIEDEYDDEDDVDIRQLSLHSYSVRALTQIEDFNDAFGTRFSDEEVDTVGGLVMQAFGHLPTRGETIEIDNYQFKVAMADSRKIIQLHVKIPDDAPIPSLDEDNLT

Flanking regions ( +/- flanking 50bp)

CTACATAATACGGCATCTTTCATTAAATCGGGGAATGTAAAAAAACCGCCATGAGCGACGACCATCCATCGGGTAGTGATACACCGAACCAGAAAAAGGGTTTCTTTTCTCTGCTGCGCCAGCAACTGTTCCACGGCGAGCCCAAAAGCCGTGAAGACCTCGTTGAGGTCATCCGTGATTCCGAACAAAATGCACTGATCGATCCTGACACCCGCGACATGCTCGAAGGGGTAATGGATATTTCTGATCAGCGTGTCCGCGATATCATGATCCCGCGTTCACAAATTGTGACTCTCAAGCGCAATCAGACACTCGACGAGTGCCTGGATGTCATTATTGATTCTGCCCACTCCCGCTTTCCGGTGATCAGTGAAGACAAAGATCACATTGAAGGCCTGCTGATGGCAAAAGATTTGCTGCCGTTTATGCGCAGTGATTCCGAAGAGTTCAGTATTGATAAAGTGCTGCGCCAGGCGGTTGTTGTGCCGGAAAGTAAGCGTGTTGACCGTCTGCTTAAGGAGTTCCGCTCCCAGCGCTATCATATGGCGATTGTGATCGATGAATTCGGCGGGGTCTCCGGACTTGTCACTATCGAGGATATTCTGGAGTTAATTGTCGGTGAAATTGAGGATGAATACGATGATGAGGATGACGTGGATATCCGTCAGCTCAGTCTGCACTCCTATTCTGTCCGCGCCCTCACCCAGATAGAAGATTTTAACGACGCATTCGGCACCCGCTTCAGTGATGAAGAGGTCGATACCGTCGGCGGGCTGGTGATGCAGGCCTTCGGCCATCTGCCGACCCGTGGTGAAACCATTGAGATTGACAACTACCAGTTCAAAGTTGCGATGGCAGACAGTCGTAAAATTATCCAGTTACATGTTAAGATTCCGGACGATGCTCCAATCCCGTCTTTAGATGAAGATAATCTGACATGATAAAATCACCTCATGGTTTACGCCAGTGGCCGCGTCTGCTGCTGGCACTG