Homologs in group_329

Help

7 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_04720 EHELCC_04720 100.0 Morganella morganii S2 nagB glucosamine-6-phosphate deaminase
NLDBIP_04720 NLDBIP_04720 100.0 Morganella morganii S4 nagB glucosamine-6-phosphate deaminase
LHKJJB_13910 LHKJJB_13910 100.0 Morganella morganii S3 nagB glucosamine-6-phosphate deaminase
HKOGLL_12625 HKOGLL_12625 100.0 Morganella morganii S5 nagB glucosamine-6-phosphate deaminase
F4V73_RS00430 F4V73_RS00430 94.4 Morganella psychrotolerans nagB glucosamine-6-phosphate deaminase
F4V73_RS04935 F4V73_RS04935 27.7 Morganella psychrotolerans - glucosamine-6-phosphate deaminase
PMI_RS02275 PMI_RS02275 76.1 Proteus mirabilis HI4320 nagB glucosamine-6-phosphate deaminase

Distribution of the homologs in the orthogroup group_329

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_329

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7MB61 3.96e-163 456 76 0 269 3 nagB Glucosamine-6-phosphate deaminase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B4ESJ0 7.09e-160 447 76 0 266 3 nagB Glucosamine-6-phosphate deaminase Proteus mirabilis (strain HI4320)
A6T6C1 2.71e-158 443 74 0 261 3 nagB Glucosamine-6-phosphate deaminase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XZG9 1.22e-157 442 73 0 261 3 nagB Glucosamine-6-phosphate deaminase Klebsiella pneumoniae (strain 342)
Q8ZQX7 1.62e-157 441 73 0 261 3 nagB Glucosamine-6-phosphate deaminase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TPZ8 1.62e-157 441 73 0 261 3 nagB Glucosamine-6-phosphate deaminase Salmonella schwarzengrund (strain CVM19633)
B5BCC5 1.62e-157 441 73 0 261 3 nagB Glucosamine-6-phosphate deaminase Salmonella paratyphi A (strain AKU_12601)
C0PWA5 1.62e-157 441 73 0 261 3 nagB Glucosamine-6-phosphate deaminase Salmonella paratyphi C (strain RKS4594)
A9MUG8 1.62e-157 441 73 0 261 3 nagB Glucosamine-6-phosphate deaminase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PCH6 1.62e-157 441 73 0 261 3 nagB Glucosamine-6-phosphate deaminase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SYN7 1.62e-157 441 73 0 261 3 nagB Glucosamine-6-phosphate deaminase Salmonella newport (strain SL254)
B4TB82 1.62e-157 441 73 0 261 3 nagB Glucosamine-6-phosphate deaminase Salmonella heidelberg (strain SL476)
B5R824 1.62e-157 441 73 0 261 3 nagB Glucosamine-6-phosphate deaminase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QWC8 1.62e-157 441 73 0 261 3 nagB Glucosamine-6-phosphate deaminase Salmonella enteritidis PT4 (strain P125109)
B5FNB9 1.62e-157 441 73 0 261 3 nagB Glucosamine-6-phosphate deaminase Salmonella dublin (strain CT_02021853)
Q57RQ0 1.62e-157 441 73 0 261 3 nagB Glucosamine-6-phosphate deaminase Salmonella choleraesuis (strain SC-B67)
B5EZC1 1.62e-157 441 73 0 261 3 nagB Glucosamine-6-phosphate deaminase Salmonella agona (strain SL483)
A8AJE0 2.68e-157 441 73 0 261 3 nagB Glucosamine-6-phosphate deaminase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q8Z8G0 6.66e-157 440 73 0 261 3 nagB Glucosamine-6-phosphate deaminase Salmonella typhi
A9MKA9 1.28e-156 439 73 0 261 3 nagB Glucosamine-6-phosphate deaminase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q3Z4C2 2.65e-156 438 73 0 261 3 nagB Glucosamine-6-phosphate deaminase Shigella sonnei (strain Ss046)
Q324M6 2.65e-156 438 73 0 261 3 nagB Glucosamine-6-phosphate deaminase Shigella boydii serotype 4 (strain Sb227)
B2TU53 2.65e-156 438 73 0 261 3 nagB Glucosamine-6-phosphate deaminase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LKT5 2.65e-156 438 73 0 261 3 nagB Glucosamine-6-phosphate deaminase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1REP9 2.65e-156 438 73 0 261 3 nagB Glucosamine-6-phosphate deaminase Escherichia coli (strain UTI89 / UPEC)
B1LLC0 2.65e-156 438 73 0 261 3 nagB Glucosamine-6-phosphate deaminase Escherichia coli (strain SMS-3-5 / SECEC)
B6HYN6 2.65e-156 438 73 0 261 3 nagB Glucosamine-6-phosphate deaminase Escherichia coli (strain SE11)
B7N9S4 2.65e-156 438 73 0 261 3 nagB Glucosamine-6-phosphate deaminase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A759 2.65e-156 438 73 0 261 1 nagB Glucosamine-6-phosphate deaminase Escherichia coli (strain K12)
B1IY50 2.65e-156 438 73 0 261 3 nagB Glucosamine-6-phosphate deaminase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q0TK13 2.65e-156 438 73 0 261 3 nagB Glucosamine-6-phosphate deaminase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1A8T7 2.65e-156 438 73 0 261 3 nagB Glucosamine-6-phosphate deaminase Escherichia coli O1:K1 / APEC
A7ZXT7 2.65e-156 438 73 0 261 3 nagB Glucosamine-6-phosphate deaminase Escherichia coli O9:H4 (strain HS)
B1X6L1 2.65e-156 438 73 0 261 3 nagB Glucosamine-6-phosphate deaminase Escherichia coli (strain K12 / DH10B)
C4ZWF4 2.65e-156 438 73 0 261 3 nagB Glucosamine-6-phosphate deaminase Escherichia coli (strain K12 / MC4100 / BW2952)
B7M5J6 2.65e-156 438 73 0 261 3 nagB Glucosamine-6-phosphate deaminase Escherichia coli O8 (strain IAI1)
B7MPI3 2.65e-156 438 73 0 261 3 nagB Glucosamine-6-phosphate deaminase Escherichia coli O81 (strain ED1a)
B7NMM9 2.65e-156 438 73 0 261 3 nagB Glucosamine-6-phosphate deaminase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YQM0 2.65e-156 438 73 0 261 3 nagB Glucosamine-6-phosphate deaminase Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A760 2.65e-156 438 73 0 261 2 nagB Glucosamine-6-phosphate deaminase Escherichia coli O157:H7
B7L9L4 2.65e-156 438 73 0 261 3 nagB Glucosamine-6-phosphate deaminase Escherichia coli (strain 55989 / EAEC)
B7MFT4 2.65e-156 438 73 0 261 3 nagB Glucosamine-6-phosphate deaminase Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UKV0 2.65e-156 438 73 0 261 3 nagB Glucosamine-6-phosphate deaminase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZJ60 2.65e-156 438 73 0 261 3 nagB Glucosamine-6-phosphate deaminase Escherichia coli O139:H28 (strain E24377A / ETEC)
P59688 6.23e-156 437 72 0 261 3 nagB Glucosamine-6-phosphate deaminase Shigella flexneri
Q0T6S6 6.23e-156 437 72 0 261 3 nagB Glucosamine-6-phosphate deaminase Shigella flexneri serotype 5b (strain 8401)
Q8FJX7 9.98e-156 437 72 0 261 3 nagB Glucosamine-6-phosphate deaminase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A4W844 6.36e-155 435 73 0 261 3 nagB Glucosamine-6-phosphate deaminase Enterobacter sp. (strain 638)
Q32IQ2 2.03e-154 433 72 0 261 3 nagB Glucosamine-6-phosphate deaminase Shigella dysenteriae serotype 1 (strain Sd197)
C6DBY4 2.5e-154 433 73 0 261 3 nagB Glucosamine-6-phosphate deaminase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
A7MQT6 1.51e-153 431 73 0 261 3 nagB Glucosamine-6-phosphate deaminase Cronobacter sakazakii (strain ATCC BAA-894)
C5BGA6 4.62e-153 430 74 0 261 3 nagB Glucosamine-6-phosphate deaminase Edwardsiella ictaluri (strain 93-146)
A7N5W3 3.11e-152 428 72 0 266 3 nagB Glucosamine-6-phosphate deaminase Vibrio campbellii (strain ATCC BAA-1116)
C3LWT7 5.09e-152 427 73 0 260 3 nagB Glucosamine-6-phosphate deaminase Vibrio cholerae serotype O1 (strain M66-2)
Q9KKS5 5.09e-152 427 73 0 260 1 nagB Glucosamine-6-phosphate deaminase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F125 5.09e-152 427 73 0 260 3 nagB Glucosamine-6-phosphate deaminase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
B1JG88 1.07e-151 427 72 0 261 3 nagB Glucosamine-6-phosphate deaminase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66DC7 1.07e-151 427 72 0 261 3 nagB Glucosamine-6-phosphate deaminase Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TNY0 1.07e-151 427 72 0 261 3 nagB Glucosamine-6-phosphate deaminase Yersinia pestis (strain Pestoides F)
Q1CKN7 1.07e-151 427 72 0 261 3 nagB Glucosamine-6-phosphate deaminase Yersinia pestis bv. Antiqua (strain Nepal516)
A9R7S4 1.07e-151 427 72 0 261 3 nagB Glucosamine-6-phosphate deaminase Yersinia pestis bv. Antiqua (strain Angola)
Q8ZDE1 1.07e-151 427 72 0 261 3 nagB Glucosamine-6-phosphate deaminase Yersinia pestis
B2K8A2 1.07e-151 427 72 0 261 3 nagB Glucosamine-6-phosphate deaminase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C537 1.07e-151 427 72 0 261 3 nagB Glucosamine-6-phosphate deaminase Yersinia pestis bv. Antiqua (strain Antiqua)
A7FKU3 1.12e-151 426 72 0 261 3 nagB Glucosamine-6-phosphate deaminase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q7MGE1 1.51e-151 426 73 0 260 3 nagB Glucosamine-6-phosphate deaminase Vibrio vulnificus (strain YJ016)
Q8D4T9 1.51e-151 426 73 0 260 3 nagB Glucosamine-6-phosphate deaminase Vibrio vulnificus (strain CMCP6)
A0KIG3 2.36e-151 426 74 0 260 3 nagB Glucosamine-6-phosphate deaminase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q87K60 2.72e-151 426 71 0 266 3 nagB Glucosamine-6-phosphate deaminase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q6D7J9 4.81e-151 425 72 0 261 3 nagB Glucosamine-6-phosphate deaminase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A8GB41 8.51e-151 424 71 0 261 3 nagB Glucosamine-6-phosphate deaminase Serratia proteamaculans (strain 568)
B8F877 1.33e-150 424 73 0 262 3 nagB Glucosamine-6-phosphate deaminase Glaesserella parasuis serovar 5 (strain SH0165)
B7VTI0 4.12e-150 422 71 0 261 3 nagB Glucosamine-6-phosphate deaminase Vibrio atlanticus (strain LGP32)
B5FBU7 4.17e-150 422 71 0 266 3 nagB Glucosamine-6-phosphate deaminase Aliivibrio fischeri (strain MJ11)
Q5E294 4.17e-150 422 71 0 266 3 nagB Glucosamine-6-phosphate deaminase Aliivibrio fischeri (strain ATCC 700601 / ES114)
A1JQE8 1.81e-149 421 71 0 261 3 nagB Glucosamine-6-phosphate deaminase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B2VBN5 2.57e-149 421 72 0 261 3 nagB Glucosamine-6-phosphate deaminase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A4SPM2 4.49e-149 420 73 0 260 3 nagB Glucosamine-6-phosphate deaminase Aeromonas salmonicida (strain A449)
Q9CMF4 2.57e-148 418 71 0 260 1 nagB Glucosamine-6-phosphate deaminase Pasteurella multocida (strain Pm70)
Q65QE8 9.78e-147 414 70 0 260 3 nagB Glucosamine-6-phosphate deaminase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
B0BSS6 5.17e-146 412 71 0 260 3 nagB Glucosamine-6-phosphate deaminase Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3GZ06 2.06e-145 410 70 0 260 3 nagB Glucosamine-6-phosphate deaminase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N353 2.06e-145 410 70 0 260 3 nagB Glucosamine-6-phosphate deaminase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
B6EN78 1.77e-144 408 70 0 261 3 nagB Glucosamine-6-phosphate deaminase Aliivibrio salmonicida (strain LFI1238)
B0UUN2 5.96e-144 407 71 0 259 3 nagB Glucosamine-6-phosphate deaminase Histophilus somni (strain 2336)
C4L889 5.02e-143 405 70 0 260 3 nagB Glucosamine-6-phosphate deaminase Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q0I4B9 5.39e-143 405 70 0 259 3 nagB Glucosamine-6-phosphate deaminase Histophilus somni (strain 129Pt)
Q4QP46 1.73e-142 403 69 0 262 1 nagB Glucosamine-6-phosphate deaminase Haemophilus influenzae (strain 86-028NP)
P44538 5.11e-142 402 69 0 262 3 nagB Glucosamine-6-phosphate deaminase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UB10 7.75e-142 402 69 0 262 3 nagB Glucosamine-6-phosphate deaminase Haemophilus influenzae (strain PittEE)
Q7VKN1 1.93e-141 400 68 0 260 3 nagB Glucosamine-6-phosphate deaminase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
C6C0A2 7.94e-139 394 68 1 261 3 nagB Glucosamine-6-phosphate deaminase Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
A1SS81 7.1e-137 389 67 0 261 3 nagB Glucosamine-6-phosphate deaminase Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
A6LHV2 3.66e-132 377 66 0 261 3 nagB Glucosamine-6-phosphate deaminase Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
Q8A094 1.82e-130 373 66 0 260 3 nagB Glucosamine-6-phosphate deaminase Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q64XP2 1.91e-128 368 65 0 261 3 nagB Glucosamine-6-phosphate deaminase Bacteroides fragilis (strain YCH46)
Q5LGU0 1.91e-128 368 65 0 261 3 nagB Glucosamine-6-phosphate deaminase Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
A6L7Q8 2.1e-128 367 65 0 259 3 nagB Glucosamine-6-phosphate deaminase Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
B2RZL5 1.67e-124 358 61 0 261 3 nagB Glucosamine-6-phosphate deaminase Borrelia hermsii (strain HS1 / DAH)
Q73QV6 1.82e-122 353 62 0 259 3 nagB Glucosamine-6-phosphate deaminase Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q29NT9 7.21e-122 351 60 0 269 3 Gnpda1 Glucosamine-6-phosphate isomerase Drosophila pseudoobscura pseudoobscura
Q7VR99 2.55e-120 347 58 0 259 3 nagB Glucosamine-6-phosphate deaminase Blochmanniella floridana
B2RJ01 6e-120 346 59 0 261 3 nagB Glucosamine-6-phosphate deaminase Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)
Q7MW43 6.69e-120 346 59 0 261 3 nagB Glucosamine-6-phosphate deaminase Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
Q5TNH5 7.52e-120 346 60 2 268 3 Gnpda1 Glucosamine-6-phosphate isomerase Anopheles gambiae
Q9VMP9 9.52e-119 343 59 0 264 2 Oscillin Glucosamine-6-phosphate isomerase Drosophila melanogaster
Q16HW7 2.8e-118 342 61 0 255 3 Gnpda1 Glucosamine-6-phosphate isomerase Aedes aegypti
B7J183 2.25e-117 340 61 0 259 3 nagB Glucosamine-6-phosphate deaminase Borreliella burgdorferi (strain ZS7)
O30564 2.25e-117 340 61 0 259 1 nagB Glucosamine-6-phosphate deaminase Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q0SP13 1.34e-116 338 60 0 259 3 nagB Glucosamine-6-phosphate deaminase Borreliella afzelii (strain PKo)
Q662L3 4.2e-115 334 59 0 261 3 nagB Glucosamine-6-phosphate deaminase Borrelia garinii subsp. bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi)
A4FV08 2.52e-114 333 60 0 255 1 GNPDA1 Glucosamine-6-phosphate isomerase 1 Bos taurus
P46926 3.17e-114 333 60 0 255 1 GNPDA1 Glucosamine-6-phosphate isomerase 1 Homo sapiens
O88958 2.12e-113 330 59 0 255 1 Gnpda1 Glucosamine-6-phosphate isomerase 1 Mus musculus
Q17QL1 2.51e-113 330 58 0 255 2 GNPDA2 Glucosamine-6-phosphate isomerase 2 Bos taurus
Q5R8T8 3.08e-113 330 59 0 255 2 GNPDA1 Glucosamine-6-phosphate isomerase 1 Pongo abelii
Q64422 7.62e-113 329 58 0 255 2 GNPDA1 Glucosamine-6-phosphate isomerase 1 Mesocricetus auratus
A4IHW6 8.62e-113 328 58 0 255 2 gnpda2 Glucosamine-6-phosphate isomerase 2 Xenopus tropicalis
Q9CRC9 8.73e-113 328 58 0 255 1 Gnpda2 Glucosamine-6-phosphate isomerase 2 Mus musculus
Q8TDQ7 1.66e-112 328 58 0 255 1 GNPDA2 Glucosamine-6-phosphate isomerase 2 Homo sapiens
Q54XK9 2.41e-112 327 57 2 265 3 gnpda1 Glucosamine-6-phosphate isomerase Dictyostelium discoideum
Q6PA43 3.31e-112 327 58 0 255 2 gnpda2 Glucosamine-6-phosphate isomerase 2 Xenopus laevis
Q8REG1 3.53e-112 327 58 1 260 3 nagB Glucosamine-6-phosphate deaminase Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q9XVJ2 1.95e-101 299 56 1 255 3 T03F6.3 Probable glucosamine-6-phosphate isomerase Caenorhabditis elegans
Q04802 5.22e-77 236 48 3 245 1 NAG1 Glucosamine-6-phosphate isomerase Candida albicans (strain SC5314 / ATCC MYA-2876)
A3QB39 4.85e-69 217 42 4 261 3 nagB Glucosamine-6-phosphate deaminase Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q8R5T0 2.88e-68 214 41 3 244 3 nagB Glucosamine-6-phosphate deaminase Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
A6VVU9 5.36e-68 214 43 4 259 3 nagB Glucosamine-6-phosphate deaminase Marinomonas sp. (strain MWYL1)
B1KFS0 5.48e-66 209 39 4 261 3 nagB Glucosamine-6-phosphate deaminase Shewanella woodyi (strain ATCC 51908 / MS32)
Q9KFQ8 5.77e-65 206 41 3 251 3 nagB Glucosamine-6-phosphate deaminase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
B3PBV0 7.1e-65 206 40 4 261 3 nagB Glucosamine-6-phosphate deaminase Cellvibrio japonicus (strain Ueda107)
B0TTP5 1.67e-64 205 41 4 259 3 nagB Glucosamine-6-phosphate deaminase Shewanella halifaxensis (strain HAW-EB4)
A0QU88 3.75e-64 204 43 2 249 1 nagB Glucosamine-6-phosphate deaminase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
O35000 4.41e-63 201 41 3 243 1 nagB Glucosamine-6-phosphate deaminase 1 Bacillus subtilis (strain 168)
Q9K487 4.85e-63 201 42 4 255 2 nagB Glucosamine-6-phosphate deaminase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
O97439 6.22e-63 201 44 2 233 3 GPI1 Glucosamine-6-phosphate isomerase 1 Giardia intestinalis
C0ZJF8 1.87e-62 199 40 2 252 3 nagB Glucosamine-6-phosphate deaminase Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
P59689 4.38e-62 199 40 3 257 3 nagB Glucosamine-6-phosphate deaminase Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
C5BY94 5.15e-62 199 46 0 214 3 nagB Glucosamine-6-phosphate deaminase Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / CCUG 43141 / JCM 11478 / NBRC 16432 / NCIMB 13614 / HKI 0122)
Q2S6X5 5.93e-62 199 47 3 226 3 nagB Glucosamine-6-phosphate deaminase Hahella chejuensis (strain KCTC 2396)
A0JY49 6.99e-62 198 41 4 257 3 nagB Glucosamine-6-phosphate deaminase Arthrobacter sp. (strain FB24)
O97440 7.02e-62 198 42 2 242 3 GPI2 Glucosamine-6-phosphate isomerase 2 Giardia intestinalis
A8FRI2 1.2e-61 198 40 3 261 3 nagB Glucosamine-6-phosphate deaminase Shewanella sediminis (strain HAW-EB3)
B0K934 1.52e-61 197 41 3 244 3 nagB Glucosamine-6-phosphate deaminase Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
Q8ESL6 3.83e-61 196 39 3 247 3 nagB Glucosamine-6-phosphate deaminase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
A7Z975 7.24e-61 195 41 3 243 3 nagB Glucosamine-6-phosphate deaminase Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
O31458 3.15e-60 194 40 2 249 2 gamA Glucosamine-6-phosphate deaminase 2 Bacillus subtilis (strain 168)
B0K0J7 4.13e-60 194 41 3 244 3 nagB Glucosamine-6-phosphate deaminase Thermoanaerobacter sp. (strain X514)
A8MIX7 1.18e-59 192 42 1 208 3 nagB Glucosamine-6-phosphate deaminase Alkaliphilus oremlandii (strain OhILAs)
C5D3L0 1.19e-59 192 40 3 244 3 nagB Glucosamine-6-phosphate deaminase Geobacillus sp. (strain WCH70)
C4LL80 2.07e-59 192 43 1 230 3 nagB Glucosamine-6-phosphate deaminase Corynebacterium kroppenstedtii (strain DSM 44385 / JCM 11950 / CIP 105744 / CCUG 35717)
B8D185 2.89e-59 191 38 3 243 3 nagB Glucosamine-6-phosphate deaminase Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562)
B2V163 3.68e-59 191 38 2 253 3 nagB Glucosamine-6-phosphate deaminase Clostridium botulinum (strain Alaska E43 / Type E3)
Q0TML8 9.6e-59 190 39 3 248 3 nagB Glucosamine-6-phosphate deaminase Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q5WHY0 1.23e-58 189 40 3 244 3 nagB Glucosamine-6-phosphate deaminase Shouchella clausii (strain KSM-K16)
B1HUU8 1.5e-58 189 44 1 203 3 nagB Glucosamine-6-phosphate deaminase Lysinibacillus sphaericus (strain C3-41)
Q8G4N5 1.55e-58 190 39 5 265 3 nagB Glucosamine-6-phosphate deaminase Bifidobacterium longum (strain NCC 2705)
B3DQQ9 1.55e-58 190 39 5 265 3 nagB Glucosamine-6-phosphate deaminase Bifidobacterium longum (strain DJO10A)
Q97MK9 1.76e-58 189 38 2 243 3 nagB Glucosamine-6-phosphate deaminase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
B2TL69 1.79e-58 189 37 2 253 3 nagB Glucosamine-6-phosphate deaminase Clostridium botulinum (strain Eklund 17B / Type B)
Q8XHP8 2.46e-58 189 39 3 248 3 nagB Glucosamine-6-phosphate deaminase Clostridium perfringens (strain 13 / Type A)
Q0SQB4 2.81e-58 189 39 3 248 3 nagB Glucosamine-6-phosphate deaminase Clostridium perfringens (strain SM101 / Type A)
Q487K8 3.4e-58 189 41 4 249 3 nagB Glucosamine-6-phosphate deaminase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
A7GH51 5.07e-58 188 37 3 250 3 nagB Glucosamine-6-phosphate deaminase Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
B1IKY4 5.07e-58 188 37 3 250 3 nagB Glucosamine-6-phosphate deaminase Clostridium botulinum (strain Okra / Type B1)
B1VI88 5.4e-58 188 40 3 256 3 nagB Glucosamine-6-phosphate deaminase Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109)
B7GQA1 8.37e-58 188 38 5 265 3 nagB Glucosamine-6-phosphate deaminase Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)
Q6NJ91 8.84e-58 188 44 0 213 3 nagB Glucosamine-6-phosphate deaminase Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
C3PJW6 9.36e-58 187 45 1 220 3 nagB Glucosamine-6-phosphate deaminase Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CIP 107346 / CN-1)
A8FHS6 2e-57 186 38 3 243 3 nagB Glucosamine-6-phosphate deaminase Bacillus pumilus (strain SAFR-032)
Q7UVM5 3.57e-57 186 45 1 208 3 nagB Glucosamine-6-phosphate deaminase Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
B8HAX3 4.11e-57 186 41 4 249 3 nagB Glucosamine-6-phosphate deaminase Pseudarthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / CIP 107037 / JCM 12360 / KCTC 9906 / NCIMB 13794 / A6)
A9KIR8 8.91e-57 184 38 3 239 3 nagB Glucosamine-6-phosphate deaminase Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
B1KZ07 1.36e-56 184 37 3 250 3 nagB Glucosamine-6-phosphate deaminase Clostridium botulinum (strain Loch Maree / Type A3)
Q0SGH6 2.27e-56 184 41 2 230 3 nagB Glucosamine-6-phosphate deaminase Rhodococcus jostii (strain RHA1)
Q18AL0 2.33e-56 184 39 3 253 3 nagB Glucosamine-6-phosphate deaminase Clostridioides difficile (strain 630)
Q6MSF4 2.47e-56 184 39 4 247 3 nagB Glucosamine-6-phosphate deaminase Mycoplasma mycoides subsp. mycoides SC (strain CCUG 32753 / NCTC 10114 / PG1)
A5I5R9 7.78e-56 182 36 3 250 3 nagB Glucosamine-6-phosphate deaminase Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FX73 7.78e-56 182 36 3 250 3 nagB Glucosamine-6-phosphate deaminase Clostridium botulinum (strain ATCC 19397 / Type A)
A6TVP5 9.2e-56 182 40 1 208 3 nagB Glucosamine-6-phosphate deaminase Alkaliphilus metalliredigens (strain QYMF)
C1FV12 2.73e-54 178 35 3 250 3 nagB Glucosamine-6-phosphate deaminase Clostridium botulinum (strain Kyoto / Type A2)
C3L2N7 2.73e-54 178 35 3 250 3 nagB Glucosamine-6-phosphate deaminase Clostridium botulinum (strain 657 / Type Ba4)
C4L2C5 7.24e-54 177 42 4 227 3 nagB Glucosamine-6-phosphate deaminase Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
Q890L6 9.35e-54 177 40 1 208 3 nagB Glucosamine-6-phosphate deaminase Clostridium tetani (strain Massachusetts / E88)
C1AW66 1.35e-53 177 40 2 230 3 nagB Glucosamine-6-phosphate deaminase Rhodococcus opacus (strain B4)
Q6AAI8 7.9e-52 172 40 4 255 3 nagB Glucosamine-6-phosphate deaminase Cutibacterium acnes (strain DSM 16379 / KPA171202)
A6M241 1.68e-50 169 36 3 245 3 nagB Glucosamine-6-phosphate deaminase Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
Q98QJ9 4.04e-50 168 36 5 258 3 nagB Glucosamine-6-phosphate deaminase Mycoplasmopsis pulmonis (strain UAB CTIP)
Q8NMD4 4.9e-50 168 42 2 212 3 nagB Glucosamine-6-phosphate deaminase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
B1YJ30 6.73e-50 167 37 6 243 3 nagB Glucosamine-6-phosphate deaminase Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
A4QH44 1.87e-49 166 42 2 212 3 nagB Glucosamine-6-phosphate deaminase Corynebacterium glutamicum (strain R)
Q1WS60 6.21e-49 164 43 5 214 3 nagB Glucosamine-6-phosphate deaminase Ligilactobacillus salivarius (strain UCC118)
Q3ID09 9.29e-49 165 43 2 208 3 nagB Glucosamine-6-phosphate deaminase Pseudoalteromonas translucida (strain TAC 125)
A0PYW1 8.23e-48 162 37 3 247 3 nagB Glucosamine-6-phosphate deaminase Clostridium novyi (strain NT)
Q4L9T8 5.63e-47 159 37 4 230 3 nagB Glucosamine-6-phosphate deaminase Staphylococcus haemolyticus (strain JCSC1435)
Q047I3 7.94e-47 159 36 5 248 3 nagB Glucosamine-6-phosphate deaminase Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q1G817 7.94e-47 159 36 5 248 3 nagB Glucosamine-6-phosphate deaminase Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
A7GS78 1.29e-46 159 40 4 207 3 nagB Glucosamine-6-phosphate deaminase Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q8EWM7 1.47e-46 159 38 4 205 3 nagB Glucosamine-6-phosphate deaminase Malacoplasma penetrans (strain HF-2)
Q6HEB2 2.38e-46 159 39 5 214 3 nagB Glucosamine-6-phosphate deaminase Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q635M6 2.38e-46 159 39 5 214 3 nagB Glucosamine-6-phosphate deaminase Bacillus cereus (strain ZK / E33L)
B9IWR7 2.38e-46 159 39 5 214 3 nagB Glucosamine-6-phosphate deaminase Bacillus cereus (strain Q1)
B7HN32 2.38e-46 159 39 5 214 3 nagB Glucosamine-6-phosphate deaminase Bacillus cereus (strain AH187)
C1EQS8 2.38e-46 159 39 5 214 3 nagB Glucosamine-6-phosphate deaminase Bacillus cereus (strain 03BB102)
Q731P4 2.38e-46 159 39 5 214 3 nagB Glucosamine-6-phosphate deaminase Bacillus cereus (strain ATCC 10987 / NRS 248)
B7JL33 2.38e-46 159 39 5 214 3 nagB Glucosamine-6-phosphate deaminase Bacillus cereus (strain AH820)
Q81MH5 2.38e-46 159 39 5 214 3 nagB Glucosamine-6-phosphate deaminase Bacillus anthracis
A0RI59 2.38e-46 159 39 5 214 3 nagB Glucosamine-6-phosphate deaminase Bacillus thuringiensis (strain Al Hakam)
C3LIR9 2.38e-46 159 39 5 214 3 nagB Glucosamine-6-phosphate deaminase Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P761 2.38e-46 159 39 5 214 3 nagB Glucosamine-6-phosphate deaminase Bacillus anthracis (strain A0248)
Q8FMI6 2.64e-46 158 35 3 249 3 nagB Glucosamine-6-phosphate deaminase Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
A9VFF7 3.11e-46 158 39 6 218 3 nagB Glucosamine-6-phosphate deaminase Bacillus mycoides (strain KBAB4)
Q819D1 3.61e-46 158 39 5 214 3 nagB Glucosamine-6-phosphate deaminase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B7H945 3.61e-46 158 39 5 214 3 nagB Glucosamine-6-phosphate deaminase Bacillus cereus (strain B4264)
Q49VB6 6.21e-46 157 39 3 214 3 nagB Glucosamine-6-phosphate deaminase Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
A9NEX8 7.52e-46 157 38 4 218 3 nagB Glucosamine-6-phosphate deaminase Acholeplasma laidlawii (strain PG-8A)
B7IWG6 9.3e-46 157 39 5 214 3 nagB Glucosamine-6-phosphate deaminase Bacillus cereus (strain G9842)
Q04G36 2.15e-45 155 39 4 215 3 nagB Glucosamine-6-phosphate deaminase Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
B9DWG4 5.34e-44 152 36 5 247 3 nagB Glucosamine-6-phosphate deaminase Streptococcus uberis (strain ATCC BAA-854 / 0140J)
Q8CTR3 3.91e-43 150 36 6 252 3 nagB Glucosamine-6-phosphate deaminase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
A3CLX4 8.7e-43 149 34 5 248 3 nagB Glucosamine-6-phosphate deaminase Streptococcus sanguinis (strain SK36)
Q8DV70 1.26e-42 148 40 4 207 1 nagB Glucosamine-6-phosphate deaminase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q5HRH8 1.33e-42 148 35 6 252 3 nagB Glucosamine-6-phosphate deaminase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q03H91 1.4e-42 148 38 4 215 3 nagB Glucosamine-6-phosphate deaminase Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
P65515 4.54e-42 147 34 5 247 3 nagB Glucosamine-6-phosphate deaminase Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P65514 4.54e-42 147 34 5 247 3 nagB Glucosamine-6-phosphate deaminase Streptococcus agalactiae serotype III (strain NEM316)
Q3K1Q7 4.54e-42 147 34 5 247 3 nagB Glucosamine-6-phosphate deaminase Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
B1MX39 9.62e-42 146 36 4 212 3 nagB Glucosamine-6-phosphate deaminase Leuconostoc citreum (strain KM20)
Q033M5 1.34e-41 145 38 4 215 3 nagB Glucosamine-6-phosphate deaminase Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
B8DEH8 1.73e-41 145 38 4 207 3 nagB Glucosamine-6-phosphate deaminase Listeria monocytogenes serotype 4a (strain HCC23)
A4VU11 2.41e-41 145 40 4 212 3 nagB Glucosamine-6-phosphate deaminase Streptococcus suis (strain 05ZYH33)
A4W0A3 2.41e-41 145 40 4 212 3 nagB Glucosamine-6-phosphate deaminase Streptococcus suis (strain 98HAH33)
Q8Y8E7 2.6e-41 145 38 4 207 3 nagB Glucosamine-6-phosphate deaminase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q74HC4 5.91e-41 144 38 4 215 3 nagB Glucosamine-6-phosphate deaminase Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q92D64 6.53e-41 144 38 4 207 3 nagB Glucosamine-6-phosphate deaminase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
A8YTN8 6.95e-41 144 38 5 216 3 nagB Glucosamine-6-phosphate deaminase Lactobacillus helveticus (strain DPC 4571)
Q721K9 1.52e-40 143 38 4 207 3 nagB Glucosamine-6-phosphate deaminase Listeria monocytogenes serotype 4b (strain F2365)
C1L1M8 1.52e-40 143 38 4 207 3 nagB Glucosamine-6-phosphate deaminase Listeria monocytogenes serotype 4b (strain CLIP80459)
P65513 1.54e-40 143 36 2 208 3 nagB Glucosamine-6-phosphate deaminase Staphylococcus aureus (strain MW2)
A8YZR7 1.54e-40 143 36 2 208 3 nagB Glucosamine-6-phosphate deaminase Staphylococcus aureus (strain USA300 / TCH1516)
Q6GBR8 1.54e-40 143 36 2 208 3 nagB Glucosamine-6-phosphate deaminase Staphylococcus aureus (strain MSSA476)
P99125 1.54e-40 143 36 2 208 1 nagB Glucosamine-6-phosphate deaminase Staphylococcus aureus (strain N315)
P65512 1.54e-40 143 36 2 208 3 nagB Glucosamine-6-phosphate deaminase Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QEM2 1.54e-40 143 36 2 208 3 nagB Glucosamine-6-phosphate deaminase Staphylococcus aureus (strain Newman)
Q5HIA6 1.54e-40 143 36 2 208 3 nagB Glucosamine-6-phosphate deaminase Staphylococcus aureus (strain COL)
A5IQC3 1.54e-40 143 36 2 208 3 nagB Glucosamine-6-phosphate deaminase Staphylococcus aureus (strain JH9)
Q2G0K8 1.54e-40 143 36 2 208 3 nagB Glucosamine-6-phosphate deaminase Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FJ71 1.54e-40 143 36 2 208 3 nagB Glucosamine-6-phosphate deaminase Staphylococcus aureus (strain USA300)
A6TZ46 1.54e-40 143 36 2 208 3 nagB Glucosamine-6-phosphate deaminase Staphylococcus aureus (strain JH1)
A7WZ06 1.54e-40 143 36 2 208 3 nagB Glucosamine-6-phosphate deaminase Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q38YK9 2.14e-40 142 37 4 208 3 nagB Glucosamine-6-phosphate deaminase Latilactobacillus sakei subsp. sakei (strain 23K)
Q2YS95 2.34e-40 143 36 2 208 3 nagB Glucosamine-6-phosphate deaminase Staphylococcus aureus (strain bovine RF122 / ET3-1)
A8AYK4 4.02e-40 142 36 5 243 3 nagB Glucosamine-6-phosphate deaminase Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
Q6GJA0 5.69e-40 142 36 2 208 3 nagB Glucosamine-6-phosphate deaminase Staphylococcus aureus (strain MRSA252)
P59687 7.09e-40 141 34 5 247 3 nagB Glucosamine-6-phosphate deaminase Enterococcus faecalis (strain ATCC 700802 / V583)
B4U206 7.77e-40 141 37 4 217 3 nagB Glucosamine-6-phosphate deaminase Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
C0M970 2.27e-39 140 37 4 211 3 nagB Glucosamine-6-phosphate deaminase Streptococcus equi subsp. equi (strain 4047)
Q5XBG4 4.45e-39 139 36 4 211 3 nagB Glucosamine-6-phosphate deaminase Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q88ZS6 5.73e-39 139 38 4 215 3 nagB Glucosamine-6-phosphate deaminase Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
C0MCU1 7.85e-39 138 37 4 217 3 nagB Glucosamine-6-phosphate deaminase Streptococcus equi subsp. zooepidemicus (strain H70)
P0DC67 5.05e-38 136 36 4 211 3 nagB Glucosamine-6-phosphate deaminase Streptococcus pyogenes serotype M3 (strain SSI-1)
P0DC66 5.05e-38 136 36 4 211 3 nagB Glucosamine-6-phosphate deaminase Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
B5XM45 5.11e-38 136 36 4 211 3 nagB Glucosamine-6-phosphate deaminase Streptococcus pyogenes serotype M49 (strain NZ131)
A2RDX6 9.78e-38 136 36 4 211 3 nagB Glucosamine-6-phosphate deaminase Streptococcus pyogenes serotype M5 (strain Manfredo)
C1CQU2 1.14e-37 135 37 4 207 3 nagB Glucosamine-6-phosphate deaminase Streptococcus pneumoniae (strain Taiwan19F-14)
C1CLC3 1.14e-37 135 37 4 207 3 nagB Glucosamine-6-phosphate deaminase Streptococcus pneumoniae (strain P1031)
C1CF03 1.14e-37 135 37 4 207 3 nagB Glucosamine-6-phosphate deaminase Streptococcus pneumoniae (strain JJA)
B8ZKX4 1.14e-37 135 37 4 207 3 nagB Glucosamine-6-phosphate deaminase Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
B1ICL5 1.14e-37 135 37 4 207 3 nagB Glucosamine-6-phosphate deaminase Streptococcus pneumoniae (strain Hungary19A-6)
B5E5S3 1.14e-37 135 37 4 207 3 nagB Glucosamine-6-phosphate deaminase Streptococcus pneumoniae serotype 19F (strain G54)
Q97Q16 1.19e-37 135 37 4 207 3 nagB Glucosamine-6-phosphate deaminase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q8DPA1 1.22e-37 135 37 4 207 3 nagB Glucosamine-6-phosphate deaminase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
C1C814 1.22e-37 135 37 4 207 3 nagB Glucosamine-6-phosphate deaminase Streptococcus pneumoniae (strain 70585)
Q04JT5 1.22e-37 135 37 4 207 3 nagB Glucosamine-6-phosphate deaminase Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q03Z95 1.83e-37 135 32 5 242 3 nagB Glucosamine-6-phosphate deaminase Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
Q8P0E0 3.35e-37 134 36 4 211 3 nagB Glucosamine-6-phosphate deaminase Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5FHT1 4.03e-37 134 35 4 215 3 nagB Glucosamine-6-phosphate deaminase Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q99Z50 5.25e-37 134 36 4 211 3 nagB Glucosamine-6-phosphate deaminase Streptococcus pyogenes serotype M1
A0AH75 8.48e-37 133 38 4 207 3 nagB Glucosamine-6-phosphate deaminase Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q8AB53 1.26e-36 140 36 4 236 3 BT_0258 Putative glucosamine-6-phosphate deaminase-like protein BT_0258 Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q03LS1 2.91e-36 132 35 4 211 3 nagB Glucosamine-6-phosphate deaminase Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
P59686 4.31e-35 128 35 4 205 2 nagB Glucosamine-6-phosphate deaminase Lysinibacillus sphaericus
A5VKB2 9.87e-35 128 33 4 212 3 nagB Glucosamine-6-phosphate deaminase Limosilactobacillus reuteri (strain DSM 20016)
Q02Y08 1.45e-33 125 32 5 243 3 nagB Glucosamine-6-phosphate deaminase Lactococcus lactis subsp. cremoris (strain SK11)
A2RJR7 1.45e-33 125 32 5 243 3 nagB Glucosamine-6-phosphate deaminase Lactococcus lactis subsp. cremoris (strain MG1363)
Q9CFA8 7.06e-33 123 34 4 207 3 nagB Glucosamine-6-phosphate deaminase Lactococcus lactis subsp. lactis (strain IL1403)
P42912 4.41e-17 81 25 6 223 3 agaI Putative deaminase AgaI Escherichia coli (strain K12)
P31470 4.43e-11 64 25 4 240 3 yieK Uncharacterized protein YieK Escherichia coli (strain K12)
Q57039 5.51e-07 52 29 5 137 3 pgl 6-phosphogluconolactonase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P70715 3.53e-06 50 31 4 116 3 pgl 6-phosphogluconolactonase Aggregatibacter actinomycetemcomitans
Q84WW2 1.35e-05 49 20 6 245 1 PGL3 6-phosphogluconolactonase 3, chloroplastic Arabidopsis thaliana
P85971 6.19e-05 47 25 10 256 1 Pgls 6-phosphogluconolactonase Rattus norvegicus
P74618 0.000218 45 25 7 186 1 pgl 6-phosphogluconolactonase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P46016 0.000412 44 22 6 225 2 pgl 6-phosphogluconolactonase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_09920
Feature type CDS
Gene nagB
Product glucosamine-6-phosphate deaminase
Location 80977 - 81786 (strand: 1)
Length 810 (nucleotides) / 269 (amino acids)

Contig

Accession contig_11
Length 143616 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_329
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF01182 Glucosamine-6-phosphate isomerases/6-phosphogluconolactonase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0363 Carbohydrate transport and metabolism (G) G 6-phosphogluconolactonase/Glucosamine-6-phosphate isomerase/deaminase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02564 glucosamine-6-phosphate deaminase [EC:3.5.99.6] Amino sugar and nucleotide sugar metabolism
Metabolic pathways
-

Protein Sequence

MRLIPLAKAQDVGQWSAQYIADKINAFRPTAERPFVLGLPTGGTPLATYKALIALHQAGKVSFRHVVTFNMDEYIGLPESHPQSYHSFMHENFFNHIDIPAENINLLNGNAPDTDAECERYEAKMKAYGGVQLFMGGVGNDGHIAFNEPGSSLTSRTRVKTLTPETRIANSRFFDNDINKVPKYALTVGVGTLMDAKELLILATGHNKAMAVQQAVEGSVNHMWTITCVQIHPKAIVVCDEPATLELKVKTLKYFCHLESDITEQFAAE

Flanking regions ( +/- flanking 50bp)

AGCAGATACCGGGCCGATAACCCGGTATAACTTAACGAGGTAGAATCGATATGCGTTTAATCCCTCTTGCGAAAGCGCAGGATGTCGGTCAGTGGTCCGCACAGTACATCGCTGACAAAATCAATGCGTTCCGCCCGACGGCTGAGCGACCGTTTGTTCTGGGACTGCCGACCGGCGGCACCCCGCTGGCCACCTACAAGGCGCTGATCGCCCTGCATCAGGCCGGAAAGGTCAGTTTCCGTCATGTGGTGACCTTTAATATGGATGAGTATATCGGCCTGCCGGAATCCCATCCGCAGAGTTATCACTCATTTATGCATGAGAATTTCTTTAATCACATTGATATCCCGGCGGAAAACATCAATCTGCTCAATGGTAATGCCCCGGATACCGATGCGGAATGTGAACGCTATGAAGCGAAGATGAAAGCTTACGGCGGTGTACAGCTGTTCATGGGCGGCGTCGGTAATGACGGTCACATTGCCTTTAACGAGCCGGGTTCATCCCTGACTTCGCGCACCCGTGTCAAAACGCTGACACCGGAAACCCGTATCGCCAACTCCCGTTTCTTTGATAATGACATCAATAAAGTGCCGAAATATGCGCTCACTGTGGGTGTCGGCACTCTGATGGATGCCAAAGAACTGCTGATCCTCGCCACCGGCCATAACAAGGCTATGGCGGTACAGCAGGCGGTTGAAGGCTCGGTGAATCATATGTGGACGATTACCTGTGTGCAGATCCACCCGAAAGCCATTGTGGTATGTGATGAACCGGCCACACTTGAGCTGAAAGTGAAAACCCTGAAGTATTTCTGTCACCTTGAATCTGACATTACCGAACAGTTTGCTGCTGAATAACCGATGCTGACCGCCCTTTATCCGGGCGGTTTTTGTTGTGTTGTCTTATC