Homologs in group_327

Help

7 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_04685 EHELCC_04685 100.0 Morganella morganii S2 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxy late synthase MenH and related esterases, alpha/beta hydrolase fold
NLDBIP_04685 NLDBIP_04685 100.0 Morganella morganii S4 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxy late synthase MenH and related esterases, alpha/beta hydrolase fold
LHKJJB_13945 LHKJJB_13945 100.0 Morganella morganii S3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxy late synthase MenH and related esterases, alpha/beta hydrolase fold
HKOGLL_12590 HKOGLL_12590 100.0 Morganella morganii S5 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxy late synthase MenH and related esterases, alpha/beta hydrolase fold
F4V73_RS00465 F4V73_RS00465 83.4 Morganella psychrotolerans - alpha/beta fold hydrolase
F4V73_RS12505 F4V73_RS12505 27.2 Morganella psychrotolerans - alpha/beta hydrolase
PMI_RS02690 PMI_RS02690 65.3 Proteus mirabilis HI4320 ybfF esterase

Distribution of the homologs in the orthogroup group_327

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_327

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P75736 2.05e-105 308 58 0 245 1 ybfF Esterase YbfF Escherichia coli (strain K12)
Q57427 1.68e-77 239 45 2 257 3 HI_0193 Putative esterase/lipase HI_0193 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8K4F5 1.03e-41 147 34 5 246 1 Abhd11 sn-1-specific diacylglycerol lipase ABHD11 Mus musculus
Q0V9K2 3.48e-41 146 35 6 250 2 abhd11 sn-1-specific diacylglycerol lipase ABHD11 Xenopus tropicalis
Q2TAP9 1.12e-40 145 36 6 250 2 abhd11 sn-1-specific diacylglycerol lipase ABHD11 Xenopus laevis
Q8NFV4 6.38e-40 143 33 6 250 1 ABHD11 sn-1-specific diacylglycerol lipase ABHD11 Homo sapiens
Q6DRD9 9.27e-39 140 32 6 265 2 abhd11 sn-1-specific diacylglycerol lipase ABHD11 Danio rerio
Q3SZ73 6.37e-34 127 29 7 268 1 ABHD11 sn-1-specific diacylglycerol lipase ABHD11 Bos taurus
O94437 4.16e-29 114 29 7 267 3 SPAC22H12.03 Abhydrolase domain-containing protein C22H12.03 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P53219 1.22e-27 111 33 10 267 1 IMO32 Probable alcohol acetyltransferase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
K0KPV8 1.76e-18 87 26 7 270 1 EAT1 Ethanol acetyltransferase 1 Wickerhamomyces ciferrii (strain ATCC 14091 / BCRC 22168 / CBS 111 / JCM 3599 / NBRC 0793 / NRRL Y-1031 F-60-10)
K0KSN3 7.55e-18 84 25 10 275 3 EAT2 Probable alcohol acetyltransferase Wickerhamomyces ciferrii (strain ATCC 14091 / BCRC 22168 / CBS 111 / JCM 3599 / NBRC 0793 / NRRL Y-1031 F-60-10)
G8JVR4 1.51e-17 84 27 7 272 1 EAT1 Ethanol acetyltransferase 1 Eremothecium cymbalariae (strain CBS 270.75 / DBVPG 7215 / KCTC 17166 / NRRL Y-17582)
A0A1E4S2N7 1.74e-17 84 23 8 263 3 EAT2 Probable alcohol acetyltransferase Cyberlindnera jadinii (strain ATCC 18201 / CBS 1600 / BCRC 20928 / JCM 3617 / NBRC 0987 / NRRL Y-1542)
A0A061AYY2 4.49e-17 83 24 8 267 3 EAT2 Probable alcohol acetyltransferase Cyberlindnera fabianii
A0A061B0Q2 4.58e-17 82 22 8 267 1 EAT1 Ethanol acetyltransferase 1 Cyberlindnera fabianii
A0A1E5RUL9 6.04e-17 82 25 8 266 1 EAT1 Ethanol acetyltransferase 1 Hanseniaspora uvarum
A0A1E3P8S6 2.08e-16 81 25 7 270 1 EAT1 Ethanol acetyltransferase 1 Wickerhamomyces anomalus (strain ATCC 58044 / CBS 1984 / NCYC 433 / NRRL Y-366-8)
A0A1E3P8S8 1.1e-15 79 23 9 269 3 EAT2 Probable alcohol acetyltransferase Wickerhamomyces anomalus (strain ATCC 58044 / CBS 1984 / NCYC 433 / NRRL Y-366-8)
A0A1E4S2P1 3.61e-15 77 22 8 279 1 EAT1 Ethanol acetyltransferase 1 Cyberlindnera jadinii (strain ATCC 18201 / CBS 1600 / BCRC 20928 / JCM 3617 / NBRC 0987 / NRRL Y-1542)
Q6CLY8 3.61e-14 74 24 9 283 1 EAT1 Ethanol acetyltransferase 1 Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)
W0T4A7 1.01e-12 70 23 9 280 1 EAT1 Ethanol acetyltransferase 1 Kluyveromyces marxianus (strain DMKU3-1042 / BCC 29191 / NBRC 104275)
Q59695 4.47e-12 68 25 5 247 3 acoC Dihydrolipoyllysine-residue acetyltransferase component of acetoin cleaving system Pseudomonas putida
G5EBI4 4.7e-11 65 22 7 272 1 ceeh-1 Epoxide hydrolase 1 Caenorhabditis elegans
O05235 5.55e-11 64 24 9 263 3 yugF Uncharacterized hydrolase YugF Bacillus subtilis (strain 168)
A0A1E5RIW9 5.96e-11 65 22 9 283 1 EAT2 Ethanol acetyltransferase 2 Hanseniaspora uvarum
P07383 7.14e-11 64 26 7 246 1 None Tropinesterase Pseudomonas putida
O52866 1.08e-10 63 33 2 119 1 None Soluble epoxide hydrolase Corynebacterium sp. (strain C12)
Q0IIS3 1.12e-09 61 23 10 272 2 ephx3 Epoxide hydrolase 3 Xenopus tropicalis
Q01398 2.02e-09 60 27 1 119 1 dehH1 Haloacetate dehalogenase H-1 Moraxella sp. (strain B)
Q1JU72 2.63e-09 60 25 3 174 1 fac-dex Fluoroacetate dehalogenase Burkholderia sp.
Q9H6B9 3.21e-09 60 22 8 263 1 EPHX3 Epoxide hydrolase 3 Homo sapiens
C6L862 5.22e-09 58 25 7 263 1 aiiM N-acyl homoserine lactonase Microbacterium testaceum (strain StLB037)
Q988D4 6.65e-09 58 24 6 253 1 mlr6787 2-(acetamidomethylene)succinate hydrolase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
P27747 1.3e-08 58 38 2 103 1 acoC Dihydrolipoyllysine-residue acetyltransferase component of acetoin cleaving system Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
I6XU97 1.92e-08 57 22 6 228 1 Rv0045c Esterase Rv0045c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q8IUS5 2.18e-08 57 32 2 99 1 EPHX4 Epoxide hydrolase 4 Homo sapiens
A4WCP8 3.16e-08 56 25 7 255 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Enterobacter sp. (strain 638)
Q6IE26 4.07e-08 57 32 2 99 2 Ephx4 Epoxide hydrolase 4 Mus musculus
P0A573 5.12e-08 56 22 6 262 3 BQ2027_MB2734 Uncharacterized protein Mb2734 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WNH3 5.12e-08 56 22 6 262 1 Rv2715 Uncharacterized protein Rv2715 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WNH2 5.12e-08 56 22 6 262 3 MT2788 Uncharacterized protein MT2788 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P53208 7.83e-08 55 37 7 105 1 EAT1 Ethanol acetyltransferase 1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P23974 1.7e-07 54 23 10 272 3 menH Putative 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Bacillus subtilis (strain 168)
A8GCT3 4.09e-07 53 37 1 67 3 rutD Putative carbamate hydrolase RutD Serratia proteamaculans (strain 568)
B0SW62 6.57e-07 52 24 6 262 3 rutD Putative carbamate hydrolase RutD Caulobacter sp. (strain K31)
Q59093 1.06e-06 52 25 4 222 4 pcaD 3-oxoadipate enol-lactonase 1 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
H2KZ86 1.24e-06 52 23 10 265 1 abhd-5.2 Abhydrolase domain-containing protein abhd-5.2 Caenorhabditis elegans
L0TC47 1.33e-06 52 26 5 215 1 lipV Lipase LipV Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P91143 1.4e-06 52 24 9 268 3 abhd-5.1 Abhydrolase domain-containing protein abhd-5.1 Caenorhabditis elegans
Q8R164 1.59e-06 51 23 5 220 1 Bphl Valacyclovir hydrolase Mus musculus
O18391 1.7e-06 52 29 2 119 2 kraken Probable serine hydrolase Drosophila melanogaster
Q8EG65 1.73e-06 51 22 8 263 1 oleB Cis-3-alkyl-4-alkyloxetan-2-one decarboxylase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q4W8C9 2.34e-06 51 33 3 122 1 phaZc 3-hydroxybutyrate-oligomer hydrolase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
O34592 2.89e-06 50 21 6 255 2 ydjP AB hydrolase superfamily protein YdjP Bacillus subtilis (strain 168)
B1ZB18 3.54e-06 50 26 7 265 3 rutD Putative carbamate hydrolase RutD Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
Q02104 3.74e-06 50 32 3 101 1 lip1 Lipase 1 Psychrobacter immobilis
A0A0E4AE72 3.94e-06 50 25 9 251 1 aqdC1 2-heptyl-3-hydroxy-4-quinolone dioxygenase AqdC1 Rhodococcus erythropolis
A2BGU9 4.13e-06 50 28 1 102 2 serhl Serine hydrolase-like protein Danio rerio
P23106 6.59e-06 49 25 11 259 1 xylF 2-hydroxymuconate semialdehyde hydrolase Pseudomonas putida
P24640 1.93e-05 48 25 7 227 1 lip3 Lipase 3 Moraxella sp. (strain TA144)
C7CM33 1.98e-05 48 31 2 117 3 rutD Putative carbamate hydrolase RutD Methylorubrum extorquens (strain DSM 6343 / CIP 106787 / DM4)
O31581 2.52e-05 48 33 4 103 3 yfhM AB hydrolase superfamily protein YfhM Bacillus subtilis (strain 168)
A1JMX1 2.55e-05 48 31 5 123 3 rutD Putative carbamate hydrolase RutD Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
C5CN82 3.58e-05 47 29 3 119 3 rutD Putative carbamate hydrolase RutD Variovorax paradoxus (strain S110)
A8ADX0 4.88e-05 47 32 3 86 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
P96688 5.11e-05 47 26 11 246 1 nap Uncharacterized carboxylesterase nap Bacillus subtilis (strain 168)
O32234 5.52e-05 47 25 10 212 2 yvaM AB hydrolase superfamily protein YvaM Bacillus subtilis (strain 168)
D5VGV3 5.65e-05 47 32 1 98 3 rutD Putative carbamate hydrolase RutD Caulobacter segnis (strain ATCC 21756 / DSM 7131 / JCM 7823 / NBRC 15250 / LMG 17158 / TK0059)
P9WNH5 6.48e-05 47 24 8 236 1 hsaD 4,5:9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate hydrolase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WNH4 6.48e-05 47 24 8 236 3 hsaD 4,5:9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate hydrolase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q86WA6 7.17e-05 47 22 7 253 1 BPHL Valacyclovir hydrolase Homo sapiens
B1M5I5 7.81e-05 46 30 2 113 3 rutD Putative carbamate hydrolase RutD Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
Q5EA59 8.02e-05 47 25 15 284 2 ABHD4 (Lyso)-N-acylphosphatidylethanolamine lipase Bos taurus
P19076 0.000108 46 22 7 256 3 dmpD 2-hydroxymuconate semialdehyde hydrolase Pseudomonas sp. (strain CF600)
B7KWT4 0.000108 46 31 2 115 3 rutD Putative carbamate hydrolase RutD Methylorubrum extorquens (strain CM4 / NCIMB 13688)
P26174 0.000127 45 32 3 102 3 bchO Magnesium-chelatase 30 kDa subunit Rhodobacter capsulatus
Q48MQ7 0.000155 45 29 3 114 3 rutD Putative carbamate hydrolase RutD Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q8ZNE9 0.000182 45 23 8 260 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q9AQM4 0.000246 45 21 7 227 1 carC 2-hydroxy-6-oxo-6-(2'-aminophenyl)hexa-2,4-dienoic acid hydrolase Pseudomonas resinovorans
Q54M29 0.000333 45 26 3 115 3 DDB_G0286239 Serine hydrolase-like protein DDB_G0286239 Dictyostelium discoideum
I6YC03 0.000337 45 27 4 124 1 ephB Epoxide hydrolase B Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P95276 0.000337 45 27 4 124 1 MT1988 Epoxide hydrolase B Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q5SK89 0.000341 45 38 1 59 3 metXA Homoserine O-acetyltransferase Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
A1JKU0 0.000346 44 23 4 160 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q9RA51 0.00036 45 38 1 59 1 metXA Homoserine O-acetyltransferase Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
Q8TB40 0.00036 44 24 14 286 1 ABHD4 (Lyso)-N-acylphosphatidylethanolamine lipase Homo sapiens
D5CE35 0.000385 44 29 3 101 3 rutD Putative carbamate hydrolase RutD Enterobacter cloacae subsp. cloacae (strain ATCC 13047 / DSM 30054 / NBRC 13535 / NCTC 10005 / WDCM 00083 / NCDC 279-56)
Q32DS5 0.000474 44 31 3 86 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Shigella dysenteriae serotype 1 (strain Sd197)
B7M5U6 0.000492 43 31 3 86 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Escherichia coli O8 (strain IAI1)
Q7CWX3 0.000502 44 38 0 47 3 rutD Putative carbamate hydrolase RutD Agrobacterium fabrum (strain C58 / ATCC 33970)
O02218 0.00053 44 28 1 115 1 lid-1 Abhydrolase domain-containing protein lid-1 Caenorhabditis elegans
Q6GDM0 0.00065 43 30 2 102 3 SAR2661 Uncharacterized hydrolase SAR2661 Staphylococcus aureus (strain MRSA252)
Q1R9F0 0.000661 43 27 1 85 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Escherichia coli (strain UTI89 / UPEC)
A1ADB5 0.000661 43 27 1 85 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Escherichia coli O1:K1 / APEC
B7MG31 0.000661 43 27 1 85 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Escherichia coli O45:K1 (strain S88 / ExPEC)
Q5F641 0.000791 43 31 1 93 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q15KI9 0.000803 44 20 9 278 2 PHYLLO Protein PHYLLO, chloroplastic Arabidopsis thaliana

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_09885
Feature type CDS
Gene menH
Product 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxy late synthase MenH and related esterases, alpha/beta hydrolase fold
Location 73571 - 74350 (strand: 1)
Length 780 (nucleotides) / 259 (amino acids)

Contig

Accession contig_11
Length 143616 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_327
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF12697 Alpha/beta hydrolase family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0596 Coenzyme transport and metabolism (H)
General function prediction only (R)		 HR 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase fold

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K01175 esterase [EC:3.1.-.-] - -

Protein Sequence

MKLPALLHHEIFTSETSHHTTPIVLIHGLFGDLHNLGVLGRELRKTHTVVQIDVRNHGDSPRAQTMTYREMAQDVLDLIRSLNIEKVIVIGHSMGGKIAMALAALAPDVTEKLIVIDMAPVAYGVRRHDEIIAALEDVTAAGVTTRTEATAIMARRIREDGVIPFLLKSFKQGEWKFNLPVIKAQYESIIGWETLPPQQVPLLLIPGGNSSYVKPEYRDAIMAQFPQATAHVIAGCGHWVHAEKPDAVLRAISRFLDKA

Flanking regions ( +/- flanking 50bp)

CTGCCGTGTCATCATATCCGCCTGTTTTGCTCTGCGGACCGGTTGTTAATATGAAATTACCTGCATTACTTCATCATGAAATATTCACGTCTGAAACATCACATCACACCACGCCGATTGTTCTGATCCACGGTCTGTTCGGGGATCTGCATAACCTCGGGGTGCTTGGCCGTGAACTGCGGAAAACGCATACCGTGGTACAGATTGATGTCCGTAACCACGGCGATTCACCGCGCGCACAAACCATGACTTACCGGGAAATGGCGCAGGATGTACTTGATCTTATCCGCTCCCTGAACATTGAAAAAGTAATAGTGATTGGCCATTCCATGGGCGGAAAAATCGCCATGGCGCTGGCTGCACTGGCTCCGGATGTTACTGAAAAACTGATTGTTATTGATATGGCTCCCGTCGCTTACGGTGTACGTCGTCATGATGAGATTATCGCGGCACTGGAAGATGTTACTGCCGCCGGTGTCACCACACGCACTGAGGCCACCGCAATTATGGCGCGCCGCATCCGTGAGGATGGCGTTATTCCGTTCCTGCTGAAATCCTTTAAGCAGGGAGAATGGAAATTCAATCTGCCGGTTATCAAAGCACAGTATGAATCCATCATCGGATGGGAAACTTTGCCGCCGCAACAGGTTCCGCTGCTGCTTATCCCGGGCGGTAATTCATCGTATGTGAAACCGGAATACCGCGACGCTATTATGGCGCAGTTCCCGCAGGCAACCGCGCATGTGATTGCCGGATGCGGCCACTGGGTACACGCTGAAAAACCGGACGCGGTTCTGCGCGCCATCAGCCGCTTCCTGGATAAAGCCTGACAACAGTGCCGCCGTCACGGCGGCATCATTCACTGACGGAAGCTCAGTAT