Homologs in group_3298

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_04670 EHELCC_04670 100.0 Morganella morganii S2 ribN Riboflavin transporter RibN, EamA domain
NLDBIP_04670 NLDBIP_04670 100.0 Morganella morganii S4 ribN Riboflavin transporter RibN, EamA domain
LHKJJB_13960 LHKJJB_13960 100.0 Morganella morganii S3 ribN Riboflavin transporter RibN, EamA domain
HKOGLL_12575 HKOGLL_12575 100.0 Morganella morganii S5 ribN Riboflavin transporter RibN, EamA domain

Distribution of the homologs in the orthogroup group_3298

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3298

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P29939 3e-23 91 42 1 139 3 None Uncharacterized transporter in cobO 3'region Sinorhizobium sp.

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_09870
Feature type CDS
Gene ribN
Product Riboflavin transporter RibN, EamA domain
Location 70581 - 71009 (strand: 1)
Length 429 (nucleotides) / 142 (amino acids)

Contig

Accession contig_11
Length 143616 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3298
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Domains

PF00892 EamA-like transporter family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2510 Coenzyme transport and metabolism (H) H Riboflavin transporter RibN, EamA domain

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K08978 bacterial/archaeal transporter family protein - -

Protein Sequence

MSTWLIYALLSAISAAMVAVFGKMGLQHLDANTATAIRAVIMALFLVGVVVVQGKLNLISEIIENRKALFFIALSGIAGALSWLFYFMAIKNGQVSQVAPIDKLSVVFAVIFAVILFGEKISMIAAGGVALITVGALMVALG

Flanking regions ( +/- flanking 50bp)

AAATACCTTATGATATTCACATCACTAATTGATAATGGGAATTATTTATTATGAGTACCTGGCTGATCTATGCCCTGCTGTCTGCTATCAGCGCCGCAATGGTTGCTGTCTTCGGGAAAATGGGGCTGCAGCATCTGGATGCTAATACCGCAACCGCGATCCGTGCAGTGATTATGGCGCTGTTTCTGGTCGGTGTGGTGGTGGTTCAGGGAAAACTTAATCTTATCAGTGAGATAATCGAAAACCGTAAAGCCCTGTTCTTTATCGCTCTGAGCGGGATTGCCGGGGCACTTTCCTGGCTGTTCTATTTTATGGCAATAAAAAACGGTCAGGTTTCTCAGGTTGCCCCGATTGATAAACTGAGTGTGGTTTTTGCTGTGATTTTTGCCGTGATCCTGTTCGGTGAAAAAATTTCTATGATTGCGGCCGGTGGCGTTGCGCTGATCACCGTTGGTGCGCTGATGGTTGCTCTGGGCTGAGACAGGCAAAAAAAACGCGGAGGGAAAGATCCGCTCCGCGCTGCTTTTCC