Homologs in group_2809

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_16595 FBDBKF_16595 53.4 Morganella morganii S1 tnp IS3 family ISKpn54 transposase ORF A
EHELCC_12620 EHELCC_12620 100.0 Morganella morganii S2 tnp IS3 family transposase ORF A
NLDBIP_12960 NLDBIP_12960 100.0 Morganella morganii S4 tnp IS3 family transposase ORF A
LHKJJB_13595 LHKJJB_13595 100.0 Morganella morganii S3 tnp IS3 family transposase ORF A
HKOGLL_11435 HKOGLL_11435 100.0 Morganella morganii S5 tnp IS3 family transposase ORF A

Distribution of the homologs in the orthogroup group_2809

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2809

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P69962 2.18e-33 113 57 0 87 3 lcrS Low calcium response locus protein S Yersinia pseudotuberculosis serotype I (strain IP32953)
P69961 2.18e-33 113 57 0 87 3 lcrS Low calcium response locus protein S Yersinia pestis
P17985 6.45e-30 104 49 0 87 3 None Insertion element ISR1 uncharacterized 10 kDa protein A3 Rhizobium sp.
P24580 1.75e-27 98 54 1 81 3 Bmul_4720 Insertion element IS407 uncharacterized 10.0 kDa protein Burkholderia multivorans (strain ATCC 17616 / 249)
Q9Z3Q1 8.31e-05 42 34 2 85 3 syrB2 Probable transcriptional regulator syrB2 Rhizobium meliloti (strain 1021)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_08905
Feature type CDS
Gene tnp
Product IS3 family transposase ORF A
Location 163161 - 163430 (strand: -1)
Length 270 (nucleotides) / 89 (amino acids)
In genomic island -

Contig

Accession contig_9
Length 163724 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2809
Orthogroup size 6
N. genomes 5

Actions

Genomic region

Domains

PF01527 Transposase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2963 Mobilome: prophages, transposons (X) X Transposase InsE and inactivated derivatives

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07497 putative transposase - -

Protein Sequence

MKKVRFTETQIVNILKLADSGLKVEEICRQNGISNATYYNWKSKYGGMEANDVKRLKELEDENSRLKKLFAEVSLENHAMKELFAKKGW

Flanking regions ( +/- flanking 50bp)

ATGAGACAACTATAATTAGATTTTCTGCCTTCACATTTGCAGAGGTCAAAATGAAAAAAGTACGTTTTACTGAAACTCAGATCGTTAATATCCTGAAGCTTGCTGATTCAGGCCTGAAGGTTGAAGAAATCTGCCGTCAGAACGGAATAAGTAATGCGACTTATTACAATTGGAAATCTAAGTATGGCGGCATGGAAGCCAATGATGTTAAAAGATTAAAAGAGCTTGAAGATGAAAACTCTCGGCTGAAAAAGCTCTTTGCTGAAGTCAGTCTAGAAAATCATGCCATGAAGGAACTTTTCGCAAAAAAGGGCTGGTAATAACCGAGAAAAAATCCTGCGCCGGGCTATTAACGGTCTCAGGCTTATCG