Homologs in group_2806

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_12785 EHELCC_12785 100.0 Morganella morganii S2 ridA Enamine deaminase RidA, house cleaning of reactive enamine intermediates, YjgF/YER057c/UK114 family
NLDBIP_13125 NLDBIP_13125 100.0 Morganella morganii S4 ridA Enamine deaminase RidA, house cleaning of reactive enamine intermediates, YjgF/YER057c/UK114 family
LHKJJB_13430 LHKJJB_13430 100.0 Morganella morganii S3 ridA Enamine deaminase RidA, house cleaning of reactive enamine intermediates, YjgF/YER057c/UK114 family
HKOGLL_11600 HKOGLL_11600 100.0 Morganella morganii S5 ridA Enamine deaminase RidA, house cleaning of reactive enamine intermediates, YjgF/YER057c/UK114 family
F4V73_RS01630 F4V73_RS01630 65.6 Morganella psychrotolerans - RidA family protein

Distribution of the homologs in the orthogroup group_2806

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2806

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
O96876 4.23e-29 107 38 2 144 1 TCP17 Protein TCP17 Trypanosoma cruzi

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_08740
Feature type CDS
Gene ridA
Product Enamine deaminase RidA, house cleaning of reactive enamine intermediates, YjgF/YER057c/UK114 family
Location 130628 - 131086 (strand: -1)
Length 459 (nucleotides) / 152 (amino acids)
In genomic island -

Contig

Accession contig_9
Length 163724 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2806
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF14588 YjgF/chorismate_mutase-like, putative endoribonuclease

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0251 Defense mechanisms (V) V Enamine deaminase RidA, house cleaning of reactive enamine intermediates, YjgF/YER057c/UK114 family

Protein Sequence

MTDVYARLKALNIELPPVVVPDAKFQPYVIFDNTITLSGHLSKTGEQLNTGKFGADLTIAQGEKIARQLAVNLLGTLQGAVGDLNKIKKIINLNCMINGTQDFTDPHVVANACSQVFHDVFGEKGYHSRNALTVAQLPFGACMEISLIAGIE

Flanking regions ( +/- flanking 50bp)

GGCGTAAAGTGGCGGGCCTGGAACTGGTGGAATAACGGAAGGAAATAACCATGACTGATGTTTATGCCCGTTTAAAAGCACTGAATATTGAACTGCCGCCGGTCGTTGTACCGGATGCAAAATTTCAGCCGTATGTGATTTTTGATAACACAATTACCCTCTCCGGCCATTTATCCAAAACCGGGGAGCAGTTAAATACCGGTAAGTTCGGGGCGGATCTGACCATTGCACAGGGTGAGAAAATTGCCCGTCAGCTGGCTGTTAACCTGCTCGGTACACTGCAGGGCGCGGTTGGTGATCTGAATAAGATTAAAAAGATCATCAACCTGAACTGCATGATTAACGGTACACAGGATTTTACCGATCCTCACGTGGTAGCGAATGCCTGCTCACAGGTTTTCCATGATGTTTTTGGTGAGAAAGGCTATCACAGCCGCAATGCACTCACTGTGGCACAACTGCCGTTCGGCGCCTGTATGGAAATATCGCTGATCGCGGGTATTGAGTAACAGAACAGTACGGGCGCGATATCTGCGCGCCCGCTTTTACCGGCGTTATG