Homologs in group_1448

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_12925 EHELCC_12925 100.0 Morganella morganii S2 rpmA 50S ribosomal protein L27
NLDBIP_13265 NLDBIP_13265 100.0 Morganella morganii S4 rpmA 50S ribosomal protein L27
LHKJJB_13290 LHKJJB_13290 100.0 Morganella morganii S3 rpmA 50S ribosomal protein L27
HKOGLL_11740 HKOGLL_11740 100.0 Morganella morganii S5 rpmA 50S ribosomal protein L27
F4V73_RS09825 F4V73_RS09825 95.3 Morganella psychrotolerans rpmA 50S ribosomal protein L27
PMI_RS16955 PMI_RS16955 97.6 Proteus mirabilis HI4320 rpmA 50S ribosomal protein L27

Distribution of the homologs in the orthogroup group_1448

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1448

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4F2A7 7.85e-55 167 97 0 85 3 rpmA Large ribosomal subunit protein bL27 Proteus mirabilis (strain HI4320)
Q7MYX5 1.75e-54 166 96 0 85 3 rpmA Large ribosomal subunit protein bL27 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B1JMJ6 6.91e-54 164 96 0 85 3 rpmA Large ribosomal subunit protein bL27 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66F75 6.91e-54 164 96 0 85 3 rpmA Large ribosomal subunit protein bL27 Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TRJ8 6.91e-54 164 96 0 85 3 rpmA Large ribosomal subunit protein bL27 Yersinia pestis (strain Pestoides F)
Q1CEJ8 6.91e-54 164 96 0 85 3 rpmA Large ribosomal subunit protein bL27 Yersinia pestis bv. Antiqua (strain Nepal516)
A9R588 6.91e-54 164 96 0 85 3 rpmA Large ribosomal subunit protein bL27 Yersinia pestis bv. Antiqua (strain Angola)
Q8ZBA7 6.91e-54 164 96 0 85 3 rpmA Large ribosomal subunit protein bL27 Yersinia pestis
B2K2P0 6.91e-54 164 96 0 85 3 rpmA Large ribosomal subunit protein bL27 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1CBZ2 6.91e-54 164 96 0 85 3 rpmA Large ribosomal subunit protein bL27 Yersinia pestis bv. Antiqua (strain Antiqua)
A7FMT7 6.91e-54 164 96 0 85 3 rpmA Large ribosomal subunit protein bL27 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q3YX56 8.6e-54 164 96 0 85 3 rpmA Large ribosomal subunit protein bL27 Shigella sonnei (strain Ss046)
P0A7M1 8.6e-54 164 96 0 85 3 rpmA Large ribosomal subunit protein bL27 Shigella flexneri
Q0T099 8.6e-54 164 96 0 85 3 rpmA Large ribosomal subunit protein bL27 Shigella flexneri serotype 5b (strain 8401)
Q32BE8 8.6e-54 164 96 0 85 3 rpmA Large ribosomal subunit protein bL27 Shigella dysenteriae serotype 1 (strain Sd197)
Q31W62 8.6e-54 164 96 0 85 3 rpmA Large ribosomal subunit protein bL27 Shigella boydii serotype 4 (strain Sb227)
B2U1Z2 8.6e-54 164 96 0 85 3 rpmA Large ribosomal subunit protein bL27 Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LR52 8.6e-54 164 96 0 85 3 rpmA Large ribosomal subunit protein bL27 Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1R6F2 8.6e-54 164 96 0 85 3 rpmA Large ribosomal subunit protein bL27 Escherichia coli (strain UTI89 / UPEC)
B1LGF1 8.6e-54 164 96 0 85 3 rpmA Large ribosomal subunit protein bL27 Escherichia coli (strain SMS-3-5 / SECEC)
B6I1Q8 8.6e-54 164 96 0 85 3 rpmA Large ribosomal subunit protein bL27 Escherichia coli (strain SE11)
B7NDG9 8.6e-54 164 96 0 85 3 rpmA Large ribosomal subunit protein bL27 Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A7L8 8.6e-54 164 96 0 85 1 rpmA Large ribosomal subunit protein bL27 Escherichia coli (strain K12)
B1IQT8 8.6e-54 164 96 0 85 3 rpmA Large ribosomal subunit protein bL27 Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A7L9 8.6e-54 164 96 0 85 3 rpmA Large ribosomal subunit protein bL27 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A8A500 8.6e-54 164 96 0 85 3 rpmA Large ribosomal subunit protein bL27 Escherichia coli O9:H4 (strain HS)
B1XHG1 8.6e-54 164 96 0 85 3 rpmA Large ribosomal subunit protein bL27 Escherichia coli (strain K12 / DH10B)
C4ZSS4 8.6e-54 164 96 0 85 3 rpmA Large ribosomal subunit protein bL27 Escherichia coli (strain K12 / MC4100 / BW2952)
B7M091 8.6e-54 164 96 0 85 3 rpmA Large ribosomal subunit protein bL27 Escherichia coli O8 (strain IAI1)
B7N0H8 8.6e-54 164 96 0 85 3 rpmA Large ribosomal subunit protein bL27 Escherichia coli O81 (strain ED1a)
B7NKQ2 8.6e-54 164 96 0 85 3 rpmA Large ribosomal subunit protein bL27 Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YS74 8.6e-54 164 96 0 85 3 rpmA Large ribosomal subunit protein bL27 Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A7M0 8.6e-54 164 96 0 85 3 rpmA Large ribosomal subunit protein bL27 Escherichia coli O157:H7
B7LHP5 8.6e-54 164 96 0 85 3 rpmA Large ribosomal subunit protein bL27 Escherichia coli (strain 55989 / EAEC)
B7MBV4 8.6e-54 164 96 0 85 3 rpmA Large ribosomal subunit protein bL27 Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UJ78 8.6e-54 164 96 0 85 3 rpmA Large ribosomal subunit protein bL27 Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZS81 8.6e-54 164 96 0 85 3 rpmA Large ribosomal subunit protein bL27 Escherichia coli O139:H28 (strain E24377A / ETEC)
A6TEK4 9.5e-54 164 96 0 85 3 rpmA Large ribosomal subunit protein bL27 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XSV6 9.5e-54 164 96 0 85 3 rpmA Large ribosomal subunit protein bL27 Klebsiella pneumoniae (strain 342)
A8G8Z2 1.86e-53 163 95 0 85 3 rpmA Large ribosomal subunit protein bL27 Serratia proteamaculans (strain 568)
C5BFA2 2.52e-53 163 95 0 85 3 rpmA Large ribosomal subunit protein bL27 Edwardsiella ictaluri (strain 93-146)
P66131 6.08e-53 162 95 0 85 3 rpmA Large ribosomal subunit protein bL27 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P66132 6.08e-53 162 95 0 85 3 rpmA Large ribosomal subunit protein bL27 Salmonella typhi
B4TWF5 6.08e-53 162 95 0 85 3 rpmA Large ribosomal subunit protein bL27 Salmonella schwarzengrund (strain CVM19633)
B5BGK9 6.08e-53 162 95 0 85 3 rpmA Large ribosomal subunit protein bL27 Salmonella paratyphi A (strain AKU_12601)
C0PZJ7 6.08e-53 162 95 0 85 3 rpmA Large ribosomal subunit protein bL27 Salmonella paratyphi C (strain RKS4594)
A9N752 6.08e-53 162 95 0 85 3 rpmA Large ribosomal subunit protein bL27 Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PLB5 6.08e-53 162 95 0 85 3 rpmA Large ribosomal subunit protein bL27 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T716 6.08e-53 162 95 0 85 3 rpmA Large ribosomal subunit protein bL27 Salmonella newport (strain SL254)
B4TJ23 6.08e-53 162 95 0 85 3 rpmA Large ribosomal subunit protein bL27 Salmonella heidelberg (strain SL476)
B5REQ1 6.08e-53 162 95 0 85 3 rpmA Large ribosomal subunit protein bL27 Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R0H6 6.08e-53 162 95 0 85 3 rpmA Large ribosomal subunit protein bL27 Salmonella enteritidis PT4 (strain P125109)
B5FIN4 6.08e-53 162 95 0 85 3 rpmA Large ribosomal subunit protein bL27 Salmonella dublin (strain CT_02021853)
Q57JG5 6.08e-53 162 95 0 85 3 rpmA Large ribosomal subunit protein bL27 Salmonella choleraesuis (strain SC-B67)
A9MP21 6.08e-53 162 95 0 85 3 rpmA Large ribosomal subunit protein bL27 Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5F6V4 6.08e-53 162 95 0 85 3 rpmA Large ribosomal subunit protein bL27 Salmonella agona (strain SL483)
A1JIV4 2.45e-52 160 94 0 85 3 rpmA Large ribosomal subunit protein bL27 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A7MJF4 1.02e-51 159 92 0 85 3 rpmA Large ribosomal subunit protein bL27 Cronobacter sakazakii (strain ATCC BAA-894)
A8AQ77 1.08e-51 159 92 0 85 3 rpmA Large ribosomal subunit protein bL27 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A4WEZ8 1.5e-51 159 92 0 85 3 rpmA Large ribosomal subunit protein bL27 Enterobacter sp. (strain 638)
Q0TCS5 4.16e-51 157 92 0 85 3 rpmA Large ribosomal subunit protein bL27 Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q7MP93 4.96e-51 157 89 0 85 3 rpmA Large ribosomal subunit protein bL27 Vibrio vulnificus (strain YJ016)
Q8DEC5 4.96e-51 157 89 0 85 3 rpmA Large ribosomal subunit protein bL27 Vibrio vulnificus (strain CMCP6)
B5FGF8 5.07e-51 157 89 0 85 3 rpmA Large ribosomal subunit protein bL27 Aliivibrio fischeri (strain MJ11)
Q5E872 5.07e-51 157 89 0 85 3 rpmA Large ribosomal subunit protein bL27 Aliivibrio fischeri (strain ATCC 700601 / ES114)
A3QB94 6e-51 157 92 0 84 3 rpmA Large ribosomal subunit protein bL27 Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q6D9C5 7.62e-51 157 89 0 85 3 rpmA Large ribosomal subunit protein bL27 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q87SU3 1.13e-50 156 89 0 85 3 rpmA Large ribosomal subunit protein bL27 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A7N0G1 1.13e-50 156 89 0 85 3 rpmA Large ribosomal subunit protein bL27 Vibrio campbellii (strain ATCC BAA-1116)
C6DKH7 1.26e-50 156 88 0 85 3 rpmA Large ribosomal subunit protein bL27 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
B6EL42 1.94e-50 155 88 0 85 3 rpmA Large ribosomal subunit protein bL27 Aliivibrio salmonicida (strain LFI1238)
Q12K22 2.14e-50 155 91 0 84 3 rpmA Large ribosomal subunit protein bL27 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q0HRZ7 2.85e-50 155 91 0 84 3 rpmA Large ribosomal subunit protein bL27 Shewanella sp. (strain MR-7)
Q0HLU1 2.85e-50 155 91 0 84 3 rpmA Large ribosomal subunit protein bL27 Shewanella sp. (strain MR-4)
A1RMV7 3.18e-50 155 91 0 84 3 rpmA Large ribosomal subunit protein bL27 Shewanella sp. (strain W3-18-1)
A0L073 3.18e-50 155 91 0 84 3 rpmA Large ribosomal subunit protein bL27 Shewanella sp. (strain ANA-3)
A4Y426 3.18e-50 155 91 0 84 3 rpmA Large ribosomal subunit protein bL27 Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q8EB81 3.18e-50 155 91 0 84 3 rpmA Large ribosomal subunit protein bL27 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
B2VGT1 3.39e-50 155 89 0 85 3 rpmA Large ribosomal subunit protein bL27 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A8FRU3 3.59e-50 155 92 0 83 3 rpmA Large ribosomal subunit protein bL27 Shewanella sediminis (strain HAW-EB3)
B8CSY4 6.29e-50 154 91 0 83 3 rpmA Large ribosomal subunit protein bL27 Shewanella piezotolerans (strain WP3 / JCM 13877)
A8H0U3 6.29e-50 154 91 0 83 3 rpmA Large ribosomal subunit protein bL27 Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B0TUI1 6.29e-50 154 91 0 83 3 rpmA Large ribosomal subunit protein bL27 Shewanella halifaxensis (strain HAW-EB4)
Q07YI9 8.37e-50 154 90 0 84 3 rpmA Large ribosomal subunit protein bL27 Shewanella frigidimarina (strain NCIMB 400)
C3LRG7 1.04e-49 154 88 0 84 3 rpmA Large ribosomal subunit protein bL27 Vibrio cholerae serotype O1 (strain M66-2)
Q9KUS9 1.04e-49 154 88 0 84 3 rpmA Large ribosomal subunit protein bL27 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F8P1 1.04e-49 154 88 0 84 3 rpmA Large ribosomal subunit protein bL27 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q6LV48 1.29e-49 154 88 0 84 3 rpmA Large ribosomal subunit protein bL27 Photobacterium profundum (strain SS9)
B1KGH0 1.39e-49 154 91 0 83 3 rpmA Large ribosomal subunit protein bL27 Shewanella woodyi (strain ATCC 51908 / MS32)
A1S9H4 2.48e-49 153 90 0 83 3 rpmA Large ribosomal subunit protein bL27 Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q9CNS7 4.24e-49 152 90 0 85 3 rpmA Large ribosomal subunit protein bL27 Pasteurella multocida (strain Pm70)
B7VID4 4.63e-49 152 87 0 85 3 rpmA Large ribosomal subunit protein bL27 Vibrio atlanticus (strain LGP32)
A9L429 5.97e-49 152 90 0 84 3 rpmA Large ribosomal subunit protein bL27 Shewanella baltica (strain OS195)
A6WK50 5.97e-49 152 90 0 84 3 rpmA Large ribosomal subunit protein bL27 Shewanella baltica (strain OS185)
A3D179 5.97e-49 152 90 0 84 3 rpmA Large ribosomal subunit protein bL27 Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8EC05 5.97e-49 152 90 0 84 3 rpmA Large ribosomal subunit protein bL27 Shewanella baltica (strain OS223)
Q7VP91 1.13e-48 151 89 0 85 3 rpmA Large ribosomal subunit protein bL27 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
B8F874 1.53e-48 151 89 0 85 3 rpmA Large ribosomal subunit protein bL27 Glaesserella parasuis serovar 5 (strain SH0165)
C4L9M2 1.82e-48 151 85 0 85 3 rpmA Large ribosomal subunit protein bL27 Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
B0BU26 4.02e-48 150 88 0 85 3 rpmA Large ribosomal subunit protein bL27 Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3GZE6 4.02e-48 150 88 0 85 3 rpmA Large ribosomal subunit protein bL27 Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N3T8 4.02e-48 150 88 0 85 3 rpmA Large ribosomal subunit protein bL27 Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q15PE9 4.25e-48 150 83 0 85 3 rpmA Large ribosomal subunit protein bL27 Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q47VL3 6.38e-48 149 84 0 85 3 rpmA Large ribosomal subunit protein bL27 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q65S55 7.36e-48 149 88 0 85 3 rpmA Large ribosomal subunit protein bL27 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
A6VMT9 7.36e-48 149 88 0 85 3 rpmA Large ribosomal subunit protein bL27 Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
B0UVI0 1.13e-47 149 87 0 85 3 rpmA Large ribosomal subunit protein bL27 Histophilus somni (strain 2336)
Q0I1P7 1.13e-47 149 87 0 85 3 rpmA Large ribosomal subunit protein bL27 Histophilus somni (strain 129Pt)
B4RZH4 1.47e-47 149 83 0 85 3 rpmA Large ribosomal subunit protein bL27 Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
C4K900 1.83e-47 148 85 0 85 3 rpmA Large ribosomal subunit protein bL27 Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
A5UI24 2.66e-47 148 87 0 85 3 rpmA Large ribosomal subunit protein bL27 Haemophilus influenzae (strain PittGG)
A5UDJ5 2.66e-47 148 87 0 85 3 rpmA Large ribosomal subunit protein bL27 Haemophilus influenzae (strain PittEE)
Q4QM29 2.66e-47 148 87 0 85 3 rpmA Large ribosomal subunit protein bL27 Haemophilus influenzae (strain 86-028NP)
A0KGS8 4.7e-47 147 84 0 85 3 rpmA Large ribosomal subunit protein bL27 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
P44363 2.29e-46 145 85 0 85 3 rpmA Large ribosomal subunit protein bL27 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A4SR18 3.55e-46 145 83 0 85 3 rpmA Large ribosomal subunit protein bL27 Aeromonas salmonicida (strain A449)
Q2NW36 3.79e-46 145 83 0 85 3 rpmA Large ribosomal subunit protein bL27 Sodalis glossinidius (strain morsitans)
A1TYY3 3.07e-45 142 82 0 82 3 rpmA Large ribosomal subunit protein bL27 Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
B8GQQ2 8.56e-45 141 79 0 82 3 rpmA Large ribosomal subunit protein bL27 Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q3IFF5 1.24e-44 141 78 0 85 3 rpmA Large ribosomal subunit protein bL27 Pseudoalteromonas translucida (strain TAC 125)
Q5R033 3.16e-44 140 80 0 82 3 rpmA Large ribosomal subunit protein bL27 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q21M08 3.78e-43 137 79 0 84 3 rpmA Large ribosomal subunit protein bL27 Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
A1SSB5 7.62e-43 137 81 0 85 3 rpmA Large ribosomal subunit protein bL27 Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q0AAD7 1.4e-42 136 78 0 82 3 rpmA Large ribosomal subunit protein bL27 Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
C5BQB3 1.49e-42 136 79 0 84 3 rpmA Large ribosomal subunit protein bL27 Teredinibacter turnerae (strain ATCC 39867 / T7901)
Q1R0C1 2.02e-42 135 79 0 82 3 rpmA Large ribosomal subunit protein bL27 Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q0VSE7 1.91e-41 133 77 0 83 3 rpmA Large ribosomal subunit protein bL27 Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q605N3 1.98e-41 133 75 0 82 3 rpmA Large ribosomal subunit protein bL27 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q83ED9 6.61e-40 129 75 0 84 3 rpmA Large ribosomal subunit protein bL27 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NBL4 6.61e-40 129 75 0 84 3 rpmA Large ribosomal subunit protein bL27 Coxiella burnetii (strain RSA 331 / Henzerling II)
B6J1S9 6.61e-40 129 75 0 84 3 rpmA Large ribosomal subunit protein bL27 Coxiella burnetii (strain CbuG_Q212)
B6J9K3 6.61e-40 129 75 0 84 3 rpmA Large ribosomal subunit protein bL27 Coxiella burnetii (strain CbuK_Q154)
Q3SKG3 7.61e-40 129 74 0 83 3 rpmA Large ribosomal subunit protein bL27 Thiobacillus denitrificans (strain ATCC 25259)
A5EVR0 8.98e-40 129 73 0 83 3 rpmA Large ribosomal subunit protein bL27 Dichelobacter nodosus (strain VCS1703A)
Q47AD1 1.28e-39 129 71 0 82 3 rpmA Large ribosomal subunit protein bL27 Dechloromonas aromatica (strain RCB)
Q0BL03 1.64e-39 128 75 0 83 3 rpmA Large ribosomal subunit protein bL27 Francisella tularensis subsp. holarctica (strain OSU18)
Q2A2E5 1.64e-39 128 75 0 83 3 rpmA Large ribosomal subunit protein bL27 Francisella tularensis subsp. holarctica (strain LVS)
A7NDG1 1.64e-39 128 75 0 83 3 rpmA Large ribosomal subunit protein bL27 Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
A9KEJ8 1.75e-39 128 75 0 84 3 rpmA Large ribosomal subunit protein bL27 Coxiella burnetii (strain Dugway 5J108-111)
P59513 2.35e-39 128 72 0 85 3 rpmA Large ribosomal subunit protein bL27 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
A1WY49 2.4e-39 128 73 0 84 3 rpmA Large ribosomal subunit protein bL27 Halorhodospira halophila (strain DSM 244 / SL1)
A4IZ44 3.04e-39 127 75 0 83 3 rpmA Large ribosomal subunit protein bL27 Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NGR1 3.04e-39 127 75 0 83 3 rpmA Large ribosomal subunit protein bL27 Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
A0Q5Q3 3.04e-39 127 75 0 83 3 rpmA Large ribosomal subunit protein bL27 Francisella tularensis subsp. novicida (strain U112)
B2SDE7 3.04e-39 127 75 0 83 3 rpmA Large ribosomal subunit protein bL27 Francisella tularensis subsp. mediasiatica (strain FSC147)
Q14I63 3.04e-39 127 75 0 83 3 rpmA Large ribosomal subunit protein bL27 Francisella tularensis subsp. tularensis (strain FSC 198)
A2SD35 3.09e-39 127 74 0 83 3 rpmA Large ribosomal subunit protein bL27 Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
Q2S9T2 4.33e-39 127 75 0 84 3 rpmA Large ribosomal subunit protein bL27 Hahella chejuensis (strain KCTC 2396)
B0TYK1 4.71e-39 127 75 0 83 3 rpmA Large ribosomal subunit protein bL27 Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
Q5WTF0 5.51e-39 127 71 0 85 3 rpmA Large ribosomal subunit protein bL27 Legionella pneumophila (strain Lens)
Q5ZS69 5.51e-39 127 71 0 85 3 rpmA Large ribosomal subunit protein bL27 Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A5IAS6 5.51e-39 127 71 0 85 3 rpmA Large ribosomal subunit protein bL27 Legionella pneumophila (strain Corby)
Q5X1P0 5.51e-39 127 71 0 85 3 rpmA Large ribosomal subunit protein bL27 Legionella pneumophila (strain Paris)
Q9HVL7 8.03e-39 126 76 0 84 1 rpmA Large ribosomal subunit protein bL27 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02GB0 8.03e-39 126 76 0 84 3 rpmA Large ribosomal subunit protein bL27 Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V0B0 8.03e-39 126 76 0 84 3 rpmA Large ribosomal subunit protein bL27 Pseudomonas aeruginosa (strain LESB58)
A6VBV4 8.03e-39 126 76 0 84 3 rpmA Large ribosomal subunit protein bL27 Pseudomonas aeruginosa (strain PA7)
Q2L060 1.82e-38 125 72 0 84 3 rpmA Large ribosomal subunit protein bL27 Bordetella avium (strain 197N)
Q5P7Z5 2.94e-38 125 69 0 85 3 rpmA Large ribosomal subunit protein bL27 Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q7VZX5 3.68e-38 125 71 0 84 3 rpmA Large ribosomal subunit protein bL27 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W1P1 3.68e-38 125 71 0 84 3 rpmA Large ribosomal subunit protein bL27 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WQL7 3.68e-38 125 71 0 84 3 rpmA Large ribosomal subunit protein bL27 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q1LSJ8 3.75e-38 125 75 1 85 3 rpmA Large ribosomal subunit protein bL27 Baumannia cicadellinicola subsp. Homalodisca coagulata
A4VI53 4.45e-38 124 72 0 84 3 rpmA Large ribosomal subunit protein bL27 Stutzerimonas stutzeri (strain A1501)
C3K1X7 4.8e-38 124 70 0 84 3 rpmA Large ribosomal subunit protein bL27 Pseudomonas fluorescens (strain SBW25)
A1KVV9 1.35e-37 124 75 0 82 3 rpmA Large ribosomal subunit protein bL27 Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
P66130 1.35e-37 124 75 0 82 3 rpmA Large ribosomal subunit protein bL27 Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P66129 1.35e-37 124 75 0 82 3 rpmA Large ribosomal subunit protein bL27 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9M2Z6 1.35e-37 124 75 0 82 3 rpmA Large ribosomal subunit protein bL27 Neisseria meningitidis serogroup C (strain 053442)
A1KAC9 1.45e-37 124 73 0 82 3 rpmA Large ribosomal subunit protein bL27 Azoarcus sp. (strain BH72)
Q4ZYK2 1.57e-37 123 70 0 82 3 rpmA Large ribosomal subunit protein bL27 Pseudomonas syringae pv. syringae (strain B728a)
Q889F2 1.57e-37 123 70 0 82 3 rpmA Large ribosomal subunit protein bL27 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q48NL3 1.57e-37 123 70 0 82 3 rpmA Large ribosomal subunit protein bL27 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q6F8G2 1.98e-37 123 70 0 84 3 rpmA Large ribosomal subunit protein bL27 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
B4RNP1 2.1e-37 123 75 0 82 3 rpmA Large ribosomal subunit protein bL27 Neisseria gonorrhoeae (strain NCCP11945)
Q5F685 2.1e-37 123 75 0 82 3 rpmA Large ribosomal subunit protein bL27 Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q8K9G2 2.1e-37 123 73 0 82 3 rpmA Large ribosomal subunit protein bL27 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q31IT5 2.18e-37 123 74 0 85 3 rpmA Large ribosomal subunit protein bL27 Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
A5WDV1 2.26e-37 123 71 0 83 3 rpmA Large ribosomal subunit protein bL27 Psychrobacter sp. (strain PRwf-1)
Q7NZS2 2.81e-37 123 73 0 82 3 rpmA Large ribosomal subunit protein bL27 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
B8D7S3 3.01e-37 122 71 0 82 3 rpmA Large ribosomal subunit protein bL27 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57468 3.01e-37 122 71 0 82 3 rpmA Large ribosomal subunit protein bL27 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D9H1 3.01e-37 122 71 0 82 3 rpmA Large ribosomal subunit protein bL27 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
Q3K6K8 3.99e-37 122 70 0 84 3 rpmA Large ribosomal subunit protein bL27 Pseudomonas fluorescens (strain Pf0-1)
Q4K5T7 3.99e-37 122 70 0 84 3 rpmA Large ribosomal subunit protein bL27 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
A9IM57 4.11e-37 122 70 1 82 3 rpmA Large ribosomal subunit protein bL27 Bartonella tribocorum (strain CIP 105476 / IBS 506)
A9IFF7 4.49e-37 122 70 0 84 3 rpmA Large ribosomal subunit protein bL27 Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Q7VQN1 4.97e-37 122 71 0 85 3 rpmA Large ribosomal subunit protein bL27 Blochmanniella floridana
B1Y281 5.19e-37 122 70 0 82 3 rpmA Large ribosomal subunit protein bL27 Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
A6W353 6.54e-37 122 69 0 84 3 rpmA Large ribosomal subunit protein bL27 Marinomonas sp. (strain MWYL1)
A1URM7 6.8e-37 122 69 1 82 3 rpmA Large ribosomal subunit protein bL27 Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
B5ELU3 6.81e-37 122 67 0 82 3 rpmA Large ribosomal subunit protein bL27 Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J428 6.81e-37 122 67 0 82 3 rpmA Large ribosomal subunit protein bL27 Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
B0VEJ5 8.7e-37 121 70 0 84 3 rpmA Large ribosomal subunit protein bL27 Acinetobacter baumannii (strain AYE)
A3M899 8.7e-37 121 70 0 84 3 rpmA Large ribosomal subunit protein bL27 Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B0VSH6 8.7e-37 121 70 0 84 3 rpmA Large ribosomal subunit protein bL27 Acinetobacter baumannii (strain SDF)
B2HXU8 8.7e-37 121 70 0 84 3 rpmA Large ribosomal subunit protein bL27 Acinetobacter baumannii (strain ACICU)
B7I6V8 8.7e-37 121 70 0 84 1 rpmA Large ribosomal subunit protein bL27 Acinetobacter baumannii (strain AB0057)
B7GXH9 8.7e-37 121 70 0 84 3 rpmA Large ribosomal subunit protein bL27 Acinetobacter baumannii (strain AB307-0294)
Q2Y808 1.01e-36 121 71 0 82 3 rpmA Large ribosomal subunit protein bL27 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
B3PIU8 1.01e-36 121 73 0 82 3 rpmA Large ribosomal subunit protein bL27 Cellvibrio japonicus (strain Ueda107)
Q6G507 1.18e-36 121 70 1 82 3 rpmA Large ribosomal subunit protein bL27 Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q3BW47 1.27e-36 121 69 0 85 3 rpmA Large ribosomal subunit protein bL27 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q8PN24 1.27e-36 121 69 0 85 3 rpmA Large ribosomal subunit protein bL27 Xanthomonas axonopodis pv. citri (strain 306)
Q3J6S1 1.33e-36 121 70 0 82 3 rpmA Large ribosomal subunit protein bL27 Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
C1D505 1.4e-36 121 71 0 83 3 rpmA Large ribosomal subunit protein bL27 Laribacter hongkongensis (strain HLHK9)
Q46X16 1.55e-36 120 69 0 82 3 rpmA Large ribosomal subunit protein bL27 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q82V19 1.68e-36 120 70 0 82 3 rpmA Large ribosomal subunit protein bL27 Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q2NCD6 2.04e-36 120 70 1 84 3 rpmA Large ribosomal subunit protein bL27 Erythrobacter litoralis (strain HTCC2594)
B3R899 2.15e-36 120 70 0 82 3 rpmA Large ribosomal subunit protein bL27 Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q1Q9X2 2.16e-36 120 69 0 84 3 rpmA Large ribosomal subunit protein bL27 Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q4FRD8 2.16e-36 120 69 0 84 3 rpmA Large ribosomal subunit protein bL27 Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q0K6P5 2.23e-36 120 69 0 82 3 rpmA Large ribosomal subunit protein bL27 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q493U6 2.29e-36 120 74 0 82 3 rpmA Large ribosomal subunit protein bL27 Blochmanniella pennsylvanica (strain BPEN)
B0UMS2 2.61e-36 120 68 1 82 3 rpmA Large ribosomal subunit protein bL27 Methylobacterium sp. (strain 4-46)
B1JF58 2.94e-36 120 70 0 84 3 rpmA Large ribosomal subunit protein bL27 Pseudomonas putida (strain W619)
B6IR00 2.96e-36 120 71 1 82 3 rpmA Large ribosomal subunit protein bL27 Rhodospirillum centenum (strain ATCC 51521 / SW)
Q6G0T7 3.09e-36 120 68 1 82 3 rpmA Large ribosomal subunit protein bL27 Bartonella quintana (strain Toulouse)
C1DEA5 3.54e-36 120 71 0 82 3 rpmA Large ribosomal subunit protein bL27 Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
A1VK91 3.95e-36 120 65 0 84 3 rpmA Large ribosomal subunit protein bL27 Polaromonas naphthalenivorans (strain CJ2)
A6WXR7 4.07e-36 120 68 1 83 3 rpmA Large ribosomal subunit protein bL27 Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q0AHG6 5.55e-36 119 68 0 82 3 rpmA Large ribosomal subunit protein bL27 Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
C3M9X6 5.65e-36 119 70 1 82 3 rpmA Large ribosomal subunit protein bL27 Sinorhizobium fredii (strain NBRC 101917 / NGR234)
B2JHD8 5.84e-36 119 68 0 82 3 rpmA Large ribosomal subunit protein bL27 Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q8PBH1 7.86e-36 119 68 0 85 3 rpmA Large ribosomal subunit protein bL27 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RY33 7.86e-36 119 68 0 85 3 rpmA Large ribosomal subunit protein bL27 Xanthomonas campestris pv. campestris (strain B100)
Q4US35 7.86e-36 119 68 0 85 3 rpmA Large ribosomal subunit protein bL27 Xanthomonas campestris pv. campestris (strain 8004)
Q8Z0F1 8.02e-36 119 74 1 82 3 rpmA Large ribosomal subunit protein bL27 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
A6T2D6 8.43e-36 119 68 0 82 3 rpmA Large ribosomal subunit protein bL27 Janthinobacterium sp. (strain Marseille)
Q8FYL8 8.48e-36 119 68 1 83 3 rpmA Large ribosomal subunit protein bL27 Brucella suis biovar 1 (strain 1330)
A9WWX2 8.48e-36 119 68 1 83 3 rpmA Large ribosomal subunit protein bL27 Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VSI8 8.48e-36 119 68 1 83 3 rpmA Large ribosomal subunit protein bL27 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
C0RF97 8.48e-36 119 68 1 83 3 rpmA Large ribosomal subunit protein bL27 Brucella melitensis biotype 2 (strain ATCC 23457)
A9M886 8.48e-36 119 68 1 83 3 rpmA Large ribosomal subunit protein bL27 Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q8VW58 8.48e-36 119 68 1 83 3 rpmA Large ribosomal subunit protein bL27 Brucella abortus biovar 1 (strain 9-941)
Q2YLL8 8.48e-36 119 68 1 83 3 rpmA Large ribosomal subunit protein bL27 Brucella abortus (strain 2308)
B2S810 8.48e-36 119 68 1 83 3 rpmA Large ribosomal subunit protein bL27 Brucella abortus (strain S19)
A4G8R5 9.51e-36 119 65 0 82 3 rpmA Large ribosomal subunit protein bL27 Herminiimonas arsenicoxydans
Q3A1D7 1.09e-35 119 68 1 85 3 rpmA Large ribosomal subunit protein bL27 Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q3MCZ8 1.11e-35 119 74 1 82 3 rpmA Large ribosomal subunit protein bL27 Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q5H2E6 1.22e-35 119 69 0 85 3 rpmA Large ribosomal subunit protein bL27 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2STB9 1.22e-35 119 69 0 85 3 rpmA Large ribosomal subunit protein bL27 Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2P5B5 1.22e-35 119 69 0 85 3 rpmA Large ribosomal subunit protein bL27 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q11CP4 1.23e-35 119 70 1 82 3 rpmA Large ribosomal subunit protein bL27 Chelativorans sp. (strain BNC1)
A7IH94 1.24e-35 119 67 1 82 3 rpmA Large ribosomal subunit protein bL27 Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
Q12F98 1.98e-35 118 69 0 82 3 rpmA Large ribosomal subunit protein bL27 Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q1GZ52 2.16e-35 118 73 0 82 3 rpmA Large ribosomal subunit protein bL27 Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
A4XYL3 2.39e-35 118 69 0 82 3 rpmA Large ribosomal subunit protein bL27 Pseudomonas mendocina (strain ymp)
B4SP13 2.67e-35 117 70 0 82 3 rpmA Large ribosomal subunit protein bL27 Stenotrophomonas maltophilia (strain R551-3)
Q2K2Y0 2.9e-35 117 68 1 82 3 rpmA Large ribosomal subunit protein bL27 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
B3PRY9 2.9e-35 117 68 1 82 3 rpmA Large ribosomal subunit protein bL27 Rhizobium etli (strain CIAT 652)
A4JBB7 3.02e-35 117 68 0 82 3 rpmA Large ribosomal subunit protein bL27 Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q1BZE1 3.02e-35 117 68 0 82 3 rpmA Large ribosomal subunit protein bL27 Burkholderia orbicola (strain AU 1054)
B1JVA0 3.02e-35 117 68 0 82 3 rpmA Large ribosomal subunit protein bL27 Burkholderia orbicola (strain MC0-3)
Q39JU8 3.02e-35 117 68 0 82 3 rpmA Large ribosomal subunit protein bL27 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q0BIH9 3.02e-35 117 68 0 82 3 rpmA Large ribosomal subunit protein bL27 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B4E5X1 3.02e-35 117 68 0 82 3 rpmA Large ribosomal subunit protein bL27 Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A0K4A9 3.02e-35 117 68 0 82 3 rpmA Large ribosomal subunit protein bL27 Burkholderia cenocepacia (strain HI2424)
B1YSU6 3.02e-35 117 68 0 82 3 rpmA Large ribosomal subunit protein bL27 Burkholderia ambifaria (strain MC40-6)
B8EQH6 3.28e-35 117 69 1 85 3 rpmA Large ribosomal subunit protein bL27 Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
A8HRT6 3.69e-35 117 65 1 82 3 rpmA Large ribosomal subunit protein bL27 Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q1LIP9 4.35e-35 117 69 0 82 3 rpmA Large ribosomal subunit protein bL27 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
B2FTD2 4.43e-35 117 70 0 82 3 rpmA Large ribosomal subunit protein bL27 Stenotrophomonas maltophilia (strain K279a)
B1ZL17 4.46e-35 117 67 1 82 3 rpmA Large ribosomal subunit protein bL27 Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
B2IE46 5.03e-35 117 69 1 82 3 rpmA Large ribosomal subunit protein bL27 Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
Q2SZG1 5.16e-35 117 68 0 82 3 rpmA Large ribosomal subunit protein bL27 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q9FD28 5.16e-35 117 68 0 82 3 rpmA Large ribosomal subunit protein bL27 Burkholderia pseudomallei (strain K96243)
A3NDS9 5.16e-35 117 68 0 82 3 rpmA Large ribosomal subunit protein bL27 Burkholderia pseudomallei (strain 668)
Q3JNF9 5.16e-35 117 68 0 82 3 rpmA Large ribosomal subunit protein bL27 Burkholderia pseudomallei (strain 1710b)
A3NZJ1 5.16e-35 117 68 0 82 3 rpmA Large ribosomal subunit protein bL27 Burkholderia pseudomallei (strain 1106a)
A1V0P2 5.16e-35 117 68 0 82 3 rpmA Large ribosomal subunit protein bL27 Burkholderia mallei (strain SAVP1)
Q62GV3 5.16e-35 117 68 0 82 3 rpmA Large ribosomal subunit protein bL27 Burkholderia mallei (strain ATCC 23344)
A2S5R9 5.16e-35 117 68 0 82 3 rpmA Large ribosomal subunit protein bL27 Burkholderia mallei (strain NCTC 10229)
A3MR89 5.16e-35 117 68 0 82 3 rpmA Large ribosomal subunit protein bL27 Burkholderia mallei (strain NCTC 10247)
Q92LB7 6.17e-35 117 69 1 82 3 rpmA Large ribosomal subunit protein bL27 Rhizobium meliloti (strain 1021)
Q2RV03 6.41e-35 117 67 1 85 3 rpmA Large ribosomal subunit protein bL27 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q9PAS2 6.77e-35 117 67 0 82 3 rpmA Large ribosomal subunit protein bL27 Xylella fastidiosa (strain 9a5c)
Q1IW73 7.55e-35 117 71 1 84 3 rpmA Large ribosomal subunit protein bL27 Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
B5ZUD9 8.03e-35 116 67 1 82 3 rpmA Large ribosomal subunit protein bL27 Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Q1MA80 8.03e-35 116 67 1 82 3 rpmA Large ribosomal subunit protein bL27 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
A9VYM7 8.06e-35 116 67 1 82 3 rpmA Large ribosomal subunit protein bL27 Methylorubrum extorquens (strain PA1)
B7KSH3 8.06e-35 116 67 1 82 3 rpmA Large ribosomal subunit protein bL27 Methylorubrum extorquens (strain CM4 / NCIMB 13688)
A9AI61 8.28e-35 116 68 0 82 3 rpmA Large ribosomal subunit protein bL27 Burkholderia multivorans (strain ATCC 17616 / 249)
Q88Q09 8.34e-35 116 67 0 84 3 rpmA Large ribosomal subunit protein bL27 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KMF5 8.34e-35 116 67 0 84 3 rpmA Large ribosomal subunit protein bL27 Pseudomonas putida (strain GB-1)
A5VYC5 8.34e-35 116 67 0 84 3 rpmA Large ribosomal subunit protein bL27 Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q1IF14 8.34e-35 116 67 0 84 3 rpmA Large ribosomal subunit protein bL27 Pseudomonas entomophila (strain L48)
Q87BL1 1.72e-34 115 65 0 82 3 rpmA Large ribosomal subunit protein bL27 Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B0U3R4 1.72e-34 115 65 0 82 3 rpmA Large ribosomal subunit protein bL27 Xylella fastidiosa (strain M12)
B2I6V7 1.72e-34 115 65 0 82 3 rpmA Large ribosomal subunit protein bL27 Xylella fastidiosa (strain M23)
Q13U14 1.8e-34 115 65 0 82 3 rpmA Large ribosomal subunit protein bL27 Paraburkholderia xenovorans (strain LB400)
B8DVU0 1.83e-34 115 67 1 85 3 rpmA Large ribosomal subunit protein bL27 Bifidobacterium animalis subsp. lactis (strain AD011)
B2SYV3 1.84e-34 115 65 0 82 3 rpmA Large ribosomal subunit protein bL27 Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
B9JEQ8 2.06e-34 115 65 1 82 3 rpmA Large ribosomal subunit protein bL27 Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
Q21Z00 2.17e-34 115 67 0 82 3 rpmA Large ribosomal subunit protein bL27 Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q8F7U1 2.3e-34 115 76 0 71 3 rpmA Large ribosomal subunit protein bL27 Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72NQ6 2.3e-34 115 76 0 71 3 rpmA Large ribosomal subunit protein bL27 Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q054P5 2.3e-34 115 76 0 71 3 rpmA Large ribosomal subunit protein bL27 Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04Q89 2.3e-34 115 76 0 71 3 rpmA Large ribosomal subunit protein bL27 Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
A9BP69 2.47e-34 115 66 0 84 3 rpmA Large ribosomal subunit protein bL27 Delftia acidovorans (strain DSM 14801 / SPH-1)
Q8UBR6 2.96e-34 115 67 1 82 3 rpmA Large ribosomal subunit protein bL27 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q8YJ84 3e-34 115 66 1 83 3 rpmA Large ribosomal subunit protein bL27 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
A5CVV8 3.08e-34 115 69 0 83 3 rpmA Large ribosomal subunit protein bL27 Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
C5CXX4 4.14e-34 114 68 0 82 3 rpmA Large ribosomal subunit protein bL27 Variovorax paradoxus (strain S110)
B9JUI3 4.53e-34 115 65 1 82 3 rpmA Large ribosomal subunit protein bL27 Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
Q0BRF0 4.59e-34 114 79 0 69 3 rpmA Large ribosomal subunit protein bL27 Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
B1XT34 5.3e-34 114 68 0 82 3 rpmA Large ribosomal subunit protein bL27 Polynucleobacter necessarius subsp. necessarius (strain STIR1)
A1TTD4 5.63e-34 114 68 0 82 3 rpmA Large ribosomal subunit protein bL27 Paracidovorax citrulli (strain AAC00-1)
B1M699 6.55e-34 114 65 1 82 3 rpmA Large ribosomal subunit protein bL27 Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
A6UDV3 6.6e-34 114 68 1 82 3 rpmA Large ribosomal subunit protein bL27 Sinorhizobium medicae (strain WSM419)
Q8XVK9 7.54e-34 114 65 0 82 3 rpmA Large ribosomal subunit protein bL27 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
C1CZK0 7.63e-34 114 73 1 83 3 rpmA Large ribosomal subunit protein bL27 Deinococcus deserti (strain DSM 17065 / CIP 109153 / LMG 22923 / VCD115)
A4SVA2 8.98e-34 114 68 0 82 3 rpmA Large ribosomal subunit protein bL27 Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
A1AXH4 1.01e-33 114 67 0 84 3 rpmA Large ribosomal subunit protein bL27 Ruthia magnifica subsp. Calyptogena magnifica
Q10ZG7 1.15e-33 114 68 1 82 3 rpmA Large ribosomal subunit protein bL27 Trichodesmium erythraeum (strain IMS101)
A0ZZY9 1.26e-33 113 67 1 84 3 rpmA Large ribosomal subunit protein bL27 Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a)
A1WPR6 1.29e-33 114 63 0 84 3 rpmA Large ribosomal subunit protein bL27 Verminephrobacter eiseniae (strain EF01-2)
B2UCV4 1.36e-33 113 67 0 82 3 rpmA Large ribosomal subunit protein bL27 Ralstonia pickettii (strain 12J)
Q747N0 1.65e-33 113 69 1 82 3 rpmA Large ribosomal subunit protein bL27 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
B8IEL7 2.05e-33 113 65 1 82 3 rpmA Large ribosomal subunit protein bL27 Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
B4U6N4 2.32e-33 113 71 1 83 3 rpmA Large ribosomal subunit protein bL27 Hydrogenobaculum sp. (strain Y04AAS1)
Q165Y3 2.6e-33 113 68 1 82 3 rpmA Large ribosomal subunit protein bL27 Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q5NR21 2.74e-33 112 65 1 84 3 rpmA Large ribosomal subunit protein bL27 Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
A9H0E8 2.9e-33 112 67 1 84 3 rpmA Large ribosomal subunit protein bL27 Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
B2IV09 2.96e-33 113 70 1 82 3 rpmA Large ribosomal subunit protein bL27 Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
A5FV28 3.2e-33 112 66 1 84 3 rpmA Large ribosomal subunit protein bL27 Acidiphilium cryptum (strain JF-5)
B8GYX1 3.65e-33 112 67 1 82 3 rpmA Large ribosomal subunit protein bL27 Caulobacter vibrioides (strain NA1000 / CB15N)
Q9ABB3 3.65e-33 112 67 1 82 3 rpmA Large ribosomal subunit protein bL27 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q2VZU3 3.69e-33 112 66 1 84 3 rpmA Large ribosomal subunit protein bL27 Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q39QR5 4.99e-33 112 68 1 82 3 rpmA Large ribosomal subunit protein bL27 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
B7KFE2 5.92e-33 112 69 1 82 3 rpmA Large ribosomal subunit protein bL27 Gloeothece citriformis (strain PCC 7424)
B3EUD7 6.23e-33 112 64 1 84 3 rpmA Large ribosomal subunit protein bL27 Amoebophilus asiaticus (strain 5a2)
A5VD71 6.53e-33 112 64 1 84 3 rpmA Large ribosomal subunit protein bL27 Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
Q5FUL3 7.9e-33 111 77 0 70 3 rpmA Large ribosomal subunit protein bL27 Gluconobacter oxydans (strain 621H)
Q1GRH1 1.07e-32 111 65 1 83 3 rpmA Large ribosomal subunit protein bL27 Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
Q9RY65 1.25e-32 111 71 1 84 1 rpmA Large ribosomal subunit protein bL27 Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
A1B9H4 1.3e-32 111 67 1 82 3 rpmA Large ribosomal subunit protein bL27 Paracoccus denitrificans (strain Pd 1222)
Q98EZ0 1.36e-32 111 65 1 83 3 rpmA Large ribosomal subunit protein bL27 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q8REI3 1.36e-32 111 67 1 85 3 rpmA Large ribosomal subunit protein bL27 Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q2G9U8 1.44e-32 111 62 1 83 3 rpmA Large ribosomal subunit protein bL27 Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
B7GNK2 1.47e-32 110 65 1 84 3 rpmA Large ribosomal subunit protein bL27 Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)
Q8G4U1 1.47e-32 110 65 1 84 3 rpmA Large ribosomal subunit protein bL27 Bifidobacterium longum (strain NCC 2705)
B3DPS3 1.47e-32 110 65 1 84 3 rpmA Large ribosomal subunit protein bL27 Bifidobacterium longum (strain DJO10A)
B5YJ66 1.59e-32 110 76 0 72 3 rpmA Large ribosomal subunit protein bL27 Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
B4RD67 2.09e-32 110 68 1 82 3 rpmA Large ribosomal subunit protein bL27 Phenylobacterium zucineum (strain HLK1)
A0LCZ4 2.14e-32 110 61 1 83 3 rpmA Large ribosomal subunit protein bL27 Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
Q5LRY1 2.23e-32 110 69 1 82 3 rpmA Large ribosomal subunit protein bL27 Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q89ZR3 2.25e-32 110 65 1 82 3 rpmA Large ribosomal subunit protein bL27 Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q64XL7 2.63e-32 110 65 1 82 3 rpmA Large ribosomal subunit protein bL27 Bacteroides fragilis (strain YCH46)
Q5LGR6 2.63e-32 110 65 1 82 3 rpmA Large ribosomal subunit protein bL27 Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
A8LK04 3.77e-32 110 65 1 82 3 rpmA Large ribosomal subunit protein bL27 Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
P74267 3.89e-32 110 68 1 82 3 rpmA Large ribosomal subunit protein bL27 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q6MGS4 4.41e-32 109 72 0 70 3 rpmA Large ribosomal subunit protein bL27 Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
B8HUY8 4.65e-32 109 70 1 82 3 rpmA Large ribosomal subunit protein bL27 Cyanothece sp. (strain PCC 7425 / ATCC 29141)
A1AKW2 5.48e-32 109 65 1 82 3 rpmA Large ribosomal subunit protein bL27 Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
B9L2M3 6.62e-32 109 64 1 85 3 rpmA Large ribosomal subunit protein bL27 Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2)
C4XNW1 7.16e-32 109 75 0 70 3 rpmA Large ribosomal subunit protein bL27 Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
B9L606 7.35e-32 109 65 1 82 3 rpmA Large ribosomal subunit protein bL27 Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH)
B0TBW5 1.03e-31 108 68 1 83 3 rpmA Large ribosomal subunit protein bL27 Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
A1W4A9 1.06e-31 108 64 0 82 3 rpmA Large ribosomal subunit protein bL27 Acidovorax sp. (strain JS42)
B9MDZ6 1.06e-31 108 64 0 82 3 rpmA Large ribosomal subunit protein bL27 Acidovorax ebreus (strain TPSY)
A7HT69 1.11e-31 108 63 1 82 3 rpmA Large ribosomal subunit protein bL27 Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
A8EV84 1.16e-31 108 63 1 84 3 rpmA Large ribosomal subunit protein bL27 Aliarcobacter butzleri (strain RM4018)
Q11XX3 1.19e-31 108 65 1 82 3 rpmA Large ribosomal subunit protein bL27 Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)
A0LPF8 1.31e-31 108 68 1 82 3 rpmA Large ribosomal subunit protein bL27 Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
A0T0G4 1.32e-31 108 74 0 70 3 rpl27 Large ribosomal subunit protein bL27c Phaeodactylum tricornutum (strain CCAP 1055/1)
Q3AHR5 1.49e-31 108 67 1 86 3 rpmA Large ribosomal subunit protein bL27 Synechococcus sp. (strain CC9605)
B0T395 1.65e-31 108 61 1 85 3 rpmA Large ribosomal subunit protein bL27 Caulobacter sp. (strain K31)
Q6AK06 1.74e-31 108 67 1 82 3 rpmA Large ribosomal subunit protein bL27 Desulfotalea psychrophila (strain LSv54 / DSM 12343)
B0C3C2 1.75e-31 108 69 1 82 3 rpmA Large ribosomal subunit protein bL27 Acaryochloris marina (strain MBIC 11017)
Q17Y99 2.29e-31 108 64 1 85 3 rpmA Large ribosomal subunit protein bL27 Helicobacter acinonychis (strain Sheeba)
A0T0V7 2.46e-31 107 67 0 78 3 rpl27 Large ribosomal subunit protein bL27c Thalassiosira pseudonana
Q1GHD2 2.54e-31 107 65 1 82 3 rpmA Large ribosomal subunit protein bL27 Ruegeria sp. (strain TM1040)
A7H030 2.67e-31 107 69 1 82 3 rpmA Large ribosomal subunit protein bL27 Campylobacter curvus (strain 525.92)
P56050 3.28e-31 107 64 1 85 3 rpmA Large ribosomal subunit protein bL27 Helicobacter pylori (strain ATCC 700392 / 26695)
B2USC8 3.28e-31 107 64 1 85 3 rpmA Large ribosomal subunit protein bL27 Helicobacter pylori (strain Shi470)
Q1CUK6 3.28e-31 107 64 1 85 3 rpmA Large ribosomal subunit protein bL27 Helicobacter pylori (strain HPAG1)
B5ZA63 3.28e-31 107 64 1 85 3 rpmA Large ribosomal subunit protein bL27 Helicobacter pylori (strain G27)
B6JKM6 3.28e-31 107 64 1 85 3 rpmA Large ribosomal subunit protein bL27 Helicobacter pylori (strain P12)
Q3AZG4 3.39e-31 107 67 1 86 3 rpmA Large ribosomal subunit protein bL27 Synechococcus sp. (strain CC9902)
Q5N598 3.39e-31 107 73 0 78 3 rpmA Large ribosomal subunit protein bL27 Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q9Z3H6 3.39e-31 107 73 0 78 3 rpmA Large ribosomal subunit protein bL27 Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q0I800 3.59e-31 107 65 1 86 3 rpmA Large ribosomal subunit protein bL27 Synechococcus sp. (strain CC9311)
C6BZ95 3.61e-31 107 70 0 77 3 rpmA Large ribosomal subunit protein bL27 Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
A4XJS7 4.45e-31 107 70 1 82 3 rpmA Large ribosomal subunit protein bL27 Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
B9MRB7 4.76e-31 107 70 1 82 3 rpmA Large ribosomal subunit protein bL27 Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
Q7MA29 4.94e-31 107 69 1 82 3 rpmA Large ribosomal subunit protein bL27 Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q28Q14 5.54e-31 107 63 1 82 3 rpmA Large ribosomal subunit protein bL27 Jannaschia sp. (strain CCS1)
Q7U8R7 5.68e-31 107 66 1 86 3 rpmA Large ribosomal subunit protein bL27 Parasynechococcus marenigrum (strain WH8102)
Q3AF53 6e-31 107 65 1 85 3 rpmA Large ribosomal subunit protein bL27 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
B2V8X4 6.5e-31 106 64 1 82 3 rpmA Large ribosomal subunit protein bL27 Sulfurihydrogenibium sp. (strain YO3AOP1)
A5GN79 7.52e-31 106 65 1 84 3 rpmA Large ribosomal subunit protein bL27 Synechococcus sp. (strain WH7803)
Q89X93 8.04e-31 106 63 1 82 3 rpmA Large ribosomal subunit protein bL27 Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q0AKX6 8.12e-31 106 62 1 83 3 rpmA Large ribosomal subunit protein bL27 Maricaulis maris (strain MCS10)
B9KER2 8.31e-31 106 68 1 82 3 rpmA Large ribosomal subunit protein bL27 Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060)
Q7VK83 1.05e-30 106 65 1 82 3 rpmA Large ribosomal subunit protein bL27 Helicobacter hepaticus (strain ATCC 51449 / 3B1)
C0R0P3 1.08e-30 106 62 1 85 3 rpmA Large ribosomal subunit protein bL27 Brachyspira hyodysenteriae (strain ATCC 49526 / WA1)
A9BBW8 1.13e-30 106 66 1 84 3 rpmA Large ribosomal subunit protein bL27 Prochlorococcus marinus (strain MIT 9211)
A6Q4D3 1.16e-30 106 65 1 82 3 rpmA Large ribosomal subunit protein bL27 Nitratiruptor sp. (strain SB155-2)
P49561 1.27e-30 105 64 0 79 3 rpl27 Large ribosomal subunit protein bL27c Trieres chinensis
B3E330 1.29e-30 105 64 1 82 3 rpmA Large ribosomal subunit protein bL27 Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
B8FM67 1.33e-30 105 64 1 82 3 rpmA Large ribosomal subunit protein bL27 Desulfatibacillum aliphaticivorans
B0JQG5 1.52e-30 105 63 0 85 3 rpmA Large ribosomal subunit protein bL27 Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
B7J0M6 1.66e-30 105 67 1 82 3 rpmA Large ribosomal subunit protein bL27 Borreliella burgdorferi (strain ZS7)
O51721 1.66e-30 105 67 1 82 1 rpmA Large ribosomal subunit protein bL27 Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q0SM74 1.66e-30 105 67 1 82 3 rpmA Large ribosomal subunit protein bL27 Borreliella afzelii (strain PKo)
A5E968 1.81e-30 105 64 1 82 3 rpmA Large ribosomal subunit protein bL27 Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
C0QLE8 1.83e-30 105 63 1 82 3 rpmA Large ribosomal subunit protein bL27 Desulforapulum autotrophicum (strain ATCC 43914 / DSM 3382 / VKM B-1955 / HRM2)
A7ZC11 1.9e-30 105 67 1 82 3 rpmA Large ribosomal subunit protein bL27 Campylobacter concisus (strain 13826)
B3Q726 2.01e-30 105 63 1 82 3 rpmA Large ribosomal subunit protein bL27 Rhodopseudomonas palustris (strain TIE-1)
Q6NDE9 2.01e-30 105 63 1 82 1 rpmA Large ribosomal subunit protein bL27 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q8RBA7 2.05e-30 105 64 1 85 3 rpmA Large ribosomal subunit protein bL27 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q07U70 2.33e-30 105 63 1 82 3 rpmA Large ribosomal subunit protein bL27 Rhodopseudomonas palustris (strain BisA53)
Q3IXY1 2.41e-30 105 63 1 82 3 rpmA Large ribosomal subunit protein bL27 Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A3PQI8 2.41e-30 105 63 1 82 3 rpmA Large ribosomal subunit protein bL27 Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
A1VF57 2.56e-30 105 64 1 81 3 rpmA Large ribosomal subunit protein bL27 Nitratidesulfovibrio vulgaris (strain DP4)
Q72DK1 2.56e-30 105 64 1 81 3 rpmA Large ribosomal subunit protein bL27 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
B1WWL8 2.56e-30 105 64 1 82 3 rpmA Large ribosomal subunit protein bL27 Crocosphaera subtropica (strain ATCC 51142 / BH68)
A6L8T0 2.98e-30 105 62 1 83 3 rpmA Large ribosomal subunit protein bL27 Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
Q7UPR5 3.43e-30 104 69 0 73 3 rpmA Large ribosomal subunit protein bL27 Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Q8NN51 3.43e-30 105 65 1 82 3 rpmA Large ribosomal subunit protein bL27 Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
A4QG84 3.43e-30 105 65 1 82 3 rpmA Large ribosomal subunit protein bL27 Corynebacterium glutamicum (strain R)
B6JD23 4.03e-30 105 63 1 82 3 rpmA Large ribosomal subunit protein bL27 Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
Q3SVI4 4.19e-30 105 64 1 82 3 rpmA Large ribosomal subunit protein bL27 Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
A0RR38 4.19e-30 104 67 1 82 3 rpmA Large ribosomal subunit protein bL27 Campylobacter fetus subsp. fetus (strain 82-40)
Q5HX71 4.35e-30 104 67 1 82 3 rpmA Large ribosomal subunit protein bL27 Campylobacter jejuni (strain RM1221)
A1VXH8 4.35e-30 104 67 1 82 3 rpmA Large ribosomal subunit protein bL27 Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Q9PJ31 4.35e-30 104 67 1 82 3 rpmA Large ribosomal subunit protein bL27 Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A7H1G9 4.35e-30 104 67 1 82 3 rpmA Large ribosomal subunit protein bL27 Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
A8FJQ0 4.35e-30 104 67 1 82 3 rpmA Large ribosomal subunit protein bL27 Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
Q13DL3 4.47e-30 104 62 1 82 3 rpmA Large ribosomal subunit protein bL27 Rhodopseudomonas palustris (strain BisB5)
Q1QQU2 4.62e-30 104 64 1 82 3 rpmA Large ribosomal subunit protein bL27 Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
B1XPD9 4.66e-30 104 74 0 70 3 rpmA Large ribosomal subunit protein bL27 Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
A2C732 5.04e-30 104 63 1 87 3 rpmA Large ribosomal subunit protein bL27 Prochlorococcus marinus (strain MIT 9303)
A4YKF6 5.18e-30 104 64 1 82 3 rpmA Large ribosomal subunit protein bL27 Bradyrhizobium sp. (strain ORS 278)
Q4FP47 5.36e-30 104 58 1 85 3 rpmA Large ribosomal subunit protein bL27 Pelagibacter ubique (strain HTCC1062)
A2BSR8 5.49e-30 104 64 1 84 3 rpmA Large ribosomal subunit protein bL27 Prochlorococcus marinus (strain AS9601)
A6L6D2 5.83e-30 104 64 1 82 3 rpmA Large ribosomal subunit protein bL27 Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
Q9ZMD8 6.34e-30 104 65 1 82 3 rpmA Large ribosomal subunit protein bL27 Helicobacter pylori (strain J99 / ATCC 700824)
Q7NME2 6.49e-30 104 65 1 82 3 rpmA Large ribosomal subunit protein bL27 Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
B5E957 6.57e-30 104 65 1 82 3 rpmA Large ribosomal subunit protein bL27 Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
Q2J3K2 6.67e-30 104 62 1 82 3 rpmA Large ribosomal subunit protein bL27 Rhodopseudomonas palustris (strain HaA2)
A8ZRY0 7.16e-30 103 63 1 85 3 rpmA Large ribosomal subunit protein bL27 Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)
Q057J1 7.22e-30 104 62 0 82 3 rpmA Large ribosomal subunit protein bL27 Buchnera aphidicola subsp. Cinara cedri (strain Cc)
C0QT35 7.66e-30 103 63 1 82 3 rpmA Large ribosomal subunit protein bL27 Persephonella marina (strain DSM 14350 / EX-H1)
Q7V5W4 7.72e-30 104 63 1 87 3 rpmA Large ribosomal subunit protein bL27 Prochlorococcus marinus (strain MIT 9313)
B0K416 7.91e-30 104 64 1 85 3 rpmA Large ribosomal subunit protein bL27 Thermoanaerobacter sp. (strain X514)
B0KAC0 7.91e-30 104 64 1 85 3 rpmA Large ribosomal subunit protein bL27 Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
B8DRP0 8.12e-30 104 71 0 70 3 rpmA Large ribosomal subunit protein bL27 Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
B7JZA3 1.14e-29 103 64 1 82 3 rpmA Large ribosomal subunit protein bL27 Rippkaea orientalis (strain PCC 8801 / RF-1)
B8I178 1.25e-29 103 64 0 84 3 rpmA Large ribosomal subunit protein bL27 Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
O78430 1.26e-29 103 63 1 82 3 rpl27 Large ribosomal subunit protein bL27c Guillardia theta
A5GD28 1.31e-29 103 65 1 82 3 rpmA Large ribosomal subunit protein bL27 Geotalea uraniireducens (strain Rf4)
Q46JC1 1.63e-29 103 63 1 86 3 rpmA Large ribosomal subunit protein bL27 Prochlorococcus marinus (strain NATL2A)
A2C4B8 1.63e-29 103 63 1 86 3 rpmA Large ribosomal subunit protein bL27 Prochlorococcus marinus (strain NATL1A)
P51210 1.68e-29 103 63 1 84 3 rpl27 Large ribosomal subunit protein bL27c Porphyra purpurea
Q18B22 1.75e-29 103 68 1 82 3 rpmA Large ribosomal subunit protein bL27 Clostridioides difficile (strain 630)
C6E8U2 1.9e-29 103 64 1 82 3 rpmA Large ribosomal subunit protein bL27 Geobacter sp. (strain M21)
P60493 1.92e-29 103 69 0 73 1 rpmA Large ribosomal subunit protein bL27 Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q21D07 1.94e-29 103 62 1 82 3 rpmA Large ribosomal subunit protein bL27 Rhodopseudomonas palustris (strain BisB18)
Q6AFY2 1.94e-29 103 66 1 84 3 rpmA Large ribosomal subunit protein bL27 Leifsonia xyli subsp. xyli (strain CTCB07)
A7I2Z9 2.01e-29 103 65 1 82 3 rpmA Large ribosomal subunit protein bL27 Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
A7NKS0 2.03e-29 103 63 1 84 3 rpmA Large ribosomal subunit protein bL27 Roseiflexus castenholzii (strain DSM 13941 / HLO8)
C3PI04 2.06e-29 103 67 1 82 3 rpmA Large ribosomal subunit protein bL27 Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CIP 107346 / CN-1)
Q9FLN4 2.07e-29 106 65 1 81 2 RPL27 Large ribosomal subunit protein bL27c Arabidopsis thaliana
Q8DMF2 2.11e-29 103 69 1 82 3 rpmA Large ribosomal subunit protein bL27 Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
A5CR31 2.16e-29 102 68 1 82 3 rpmA Large ribosomal subunit protein bL27 Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382)
B5RQB7 2.29e-29 102 65 1 82 3 rpmA Large ribosomal subunit protein bL27 Borrelia recurrentis (strain A1)
B5RMX2 2.29e-29 102 65 1 82 3 rpmA Large ribosomal subunit protein bL27 Borrelia duttonii (strain Ly)
Q30XV9 2.51e-29 102 70 0 70 3 rpmA Large ribosomal subunit protein bL27 Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q97JL5 2.53e-29 103 69 1 81 3 rpmA Large ribosomal subunit protein bL27 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
A1R0K3 2.91e-29 102 65 1 82 3 rpmA Large ribosomal subunit protein bL27 Borrelia turicatae (strain 91E135)
Q7VAN2 3.12e-29 102 63 1 85 3 rpmA Large ribosomal subunit protein bL27 Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
Q2LR76 3.15e-29 102 61 1 84 3 rpmA Large ribosomal subunit protein bL27 Syntrophus aciditrophicus (strain SB)
Q6NFV6 3.18e-29 102 65 1 82 3 rpmA Large ribosomal subunit protein bL27 Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
B0RDG4 3.27e-29 102 68 1 82 3 rpmA Large ribosomal subunit protein bL27 Clavibacter sepedonicus
B9K8D0 3.43e-29 102 62 1 85 3 rpmA Large ribosomal subunit protein bL27 Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E)
B0SRT6 3.44e-29 102 63 1 82 3 rpmA Large ribosomal subunit protein bL27 Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris)
B0S9A2 3.44e-29 102 63 1 82 3 rpmA Large ribosomal subunit protein bL27 Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames)
A5GV22 3.64e-29 102 63 1 84 3 rpmA Large ribosomal subunit protein bL27 Synechococcus sp. (strain RCC307)
B1LBJ4 4.14e-29 102 61 1 85 3 rpmA Large ribosomal subunit protein bL27 Thermotoga sp. (strain RQ2)
A5IMC9 4.14e-29 102 61 1 85 3 rpmA Large ribosomal subunit protein bL27 Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
Q9X1G7 4.14e-29 102 61 1 85 3 rpmA Large ribosomal subunit protein bL27 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
P30155 4.21e-29 105 66 1 81 1 RPL27 Large ribosomal subunit protein bL27c Nicotiana tabacum
O67650 4.36e-29 102 62 1 82 3 rpmA Large ribosomal subunit protein bL27 Aquifex aeolicus (strain VF5)
Q8D278 4.68e-29 102 73 0 67 3 rpmA Large ribosomal subunit protein bL27 Wigglesworthia glossinidia brevipalpis
Q1XDS7 4.86e-29 102 61 1 84 3 rpl27 Large ribosomal subunit protein bL27c Neopyropia yezoensis
Q2GCN3 4.9e-29 102 63 1 82 3 rpmA Large ribosomal subunit protein bL27 Neorickettsia sennetsu (strain ATCC VR-367 / Miyayama)
C5CDI0 4.98e-29 102 61 1 85 3 rpmA Large ribosomal subunit protein bL27 Kosmotoga olearia (strain ATCC BAA-1733 / DSM 21960 / TBF 19.5.1)
B3QSH7 6.31e-29 101 65 1 82 3 rpmA Large ribosomal subunit protein bL27 Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
B6YRH8 6.49e-29 101 60 1 83 3 rpmA Large ribosomal subunit protein bL27 Azobacteroides pseudotrichonymphae genomovar. CFP2
P82190 6.87e-29 105 63 0 77 1 RPL27 Large ribosomal subunit protein bL27c Spinacia oleracea
B8CXZ1 7.02e-29 102 65 1 85 3 rpmA Large ribosomal subunit protein bL27 Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562)
Q72HR3 7.49e-29 101 68 0 73 1 rpmA Large ribosomal subunit protein bL27 Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
B2UNV3 7.67e-29 101 64 0 73 3 rpmA Large ribosomal subunit protein bL27 Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc)
O87885 8.42e-29 101 57 0 85 3 rpmA Large ribosomal subunit protein bL27 Lawsonia intracellularis
Q92GG0 8.59e-29 101 59 1 83 3 rpmA Large ribosomal subunit protein bL27 Rickettsia conorii (strain ATCC VR-613 / Malish 7)
A3DBS4 8.83e-29 101 68 1 82 3 rpmA Large ribosomal subunit protein bL27 Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q3Z6W2 8.87e-29 101 60 1 85 3 rpmA Large ribosomal subunit protein bL27 Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195)
A8F2N7 9.04e-29 101 59 1 83 3 rpmA Large ribosomal subunit protein bL27 Rickettsia massiliae (strain Mtu5)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_08600
Feature type CDS
Gene rpmA
Product 50S ribosomal protein L27
Location 101891 - 102148 (strand: 1)
Length 258 (nucleotides) / 85 (amino acids)
In genomic island -

Contig

Accession contig_9
Length 163724 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1448
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01016 Ribosomal L27 protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0211 Translation, ribosomal structure and biogenesis (J) J Ribosomal protein L27

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02899 large subunit ribosomal protein L27 Ribosome -

Protein Sequence

MAHKKAGGSTRNGRDSEAKRLGVKRFGGEAVLAGSIIVRQRGTKFHAGSNVGCGRDHTLFALADGKVKFEVKGPKNRKFISIEAE

Flanking regions ( +/- flanking 50bp)

ACTGATGTTAAAATTACCGGTATCGCTTAAGTTAATAGGAGAGCAGATCAATGGCACACAAAAAGGCTGGCGGCTCGACTCGAAACGGTCGCGATTCTGAAGCAAAACGTCTGGGTGTAAAACGTTTCGGTGGTGAAGCTGTATTAGCAGGCAGCATCATCGTTCGTCAGCGTGGTACTAAATTCCACGCAGGCAGCAACGTAGGTTGCGGTCGCGACCACACTCTGTTCGCGTTAGCTGACGGAAAAGTCAAATTCGAAGTTAAAGGCCCGAAAAACCGTAAATTCATCAGCATCGAAGCTGAATAAGTTTTTCACGTCTTAACCGAGTCCGAAAGCCCTGCAAACCTTTTGCAGGG