Homologs in group_2773

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_13700 EHELCC_13700 100.0 Morganella morganii S2 tnaC tryptophanase leader peptide
NLDBIP_14145 NLDBIP_14145 100.0 Morganella morganii S4 tnaC tryptophanase leader peptide
LHKJJB_08705 LHKJJB_08705 100.0 Morganella morganii S3 tnaC tryptophanase leader peptide
HKOGLL_08255 HKOGLL_08255 100.0 Morganella morganii S5 tnaC tryptophanase leader peptide
F4V73_RS19365 F4V73_RS19365 75.0 Morganella psychrotolerans tnaC tryptophanase leader peptide

Distribution of the homologs in the orthogroup group_2773

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2773

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_07870
Feature type CDS
Gene tnaC
Product tryptophanase leader peptide
Location 102950 - 103048 (strand: 1)
Length 99 (nucleotides) / 32 (amino acids)

Contig

Accession contig_8
Length 164760 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2773
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Protein Sequence

MNFLSIPSRLAGVCFVQAWFNVDHRISNFFPE

Flanking regions ( +/- flanking 50bp)

TTATTCAATGTAATTTTGTGCATTACTTATCCACCCAGAGGGCTTTGTGTATGAATTTCTTATCCATCCCAAGTCGTCTTGCCGGTGTCTGCTTTGTGCAGGCATGGTTTAATGTTGATCACCGCATTTCCAACTTCTTCCCTGAGTGATTCTCCGTTTGCGTATTTACCACGAAAACTAATTAAAAACACGCTGATAT