Homologs in group_3270

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_03540 EHELCC_03540 100.0 Morganella morganii S2 yidJ putative acetyltransferase, GNAT superfamily
NLDBIP_03540 NLDBIP_03540 100.0 Morganella morganii S4 yidJ putative acetyltransferase, GNAT superfamily
LHKJJB_09370 LHKJJB_09370 100.0 Morganella morganii S3 yidJ putative acetyltransferase, GNAT superfamily
HKOGLL_09605 HKOGLL_09605 100.0 Morganella morganii S5 yidJ putative acetyltransferase, GNAT superfamily

Distribution of the homologs in the orthogroup group_3270

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3270

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P39274 2.27e-39 128 71 1 90 1 yjdJ Uncharacterized protein YjdJ Escherichia coli (strain K12)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_07430
Feature type CDS
Gene yidJ
Product putative acetyltransferase, GNAT superfamily
Location 170038 - 170319 (strand: 1)
Length 282 (nucleotides) / 93 (amino acids)
In genomic island -

Contig

Accession contig_7
Length 171383 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3270
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Domains

PF14542 GCN5-related N-acetyl-transferase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2388 General function prediction only (R) R Predicted acetyltransferase, GNAT superfamily

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K06975 uncharacterized protein - -

Protein Sequence

MDIREDETSFYILSEDGKSRIAEITFVYTGDNLAIIDHTMVDDSLRGQKVGNKLVAAVVEKMRREQRKIIPLCPFAKSVFDKTREYDDIRHAG

Flanking regions ( +/- flanking 50bp)

ATCCGCACGGTTTTGCATATAGTATTATTTTAAGCCGCAGGAGATAAGTGATGGATATTCGTGAAGATGAAACCAGTTTTTATATTCTTTCTGAGGACGGCAAAAGCCGGATAGCGGAAATCACCTTTGTGTATACCGGGGATAATCTGGCGATTATTGACCATACTATGGTGGATGACAGCCTGCGCGGGCAGAAAGTCGGTAATAAGCTGGTTGCGGCAGTGGTTGAGAAAATGCGTCGTGAACAGCGGAAAATTATTCCGCTTTGTCCGTTTGCCAAAAGCGTGTTTGATAAAACCCGTGAGTATGACGATATCCGTCACGCCGGATAATGCACAATGCCGGAGGGGAAACCGGTTTTCCCCTCACGGTACAGACAGAG